Conserved Protein Domain Family
PLN02180

?
PLN02180: PLN02180 
gamma-glutamyl transpeptidase 4
Statistics
?
PSSM-Id: 177836
View PSSM: PLN02180
Aligned: 2 rows
Threshold Bit Score: 1186.79
Threshold Setting Gi: 15233493
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297803126   1 MGDAIIADPLLCIDHETVAEKkkKKQSNYLKLALFLLLLILVATSGFSFNDKSTTVLLSRQAIHDDHSLSHGTVSDMVES 80 
15233493    1 MRDAIIADPLLAIDHETVAEK--KKQSKNLKISLLLLLILLATSGYYSFSDNITTVFLSRQAIDDDHSLSLGTISDVVES 78 
297803126  81 ENGVVAADDARCSEIGASVLRRGGHAVDAAVAITLCIGVVNPMSSGIGGGSFLIVSSQKDSKAEAFDMRETAPLAASKDM 160
15233493   79 ENGVVAADDARCSEIGASVLRSGGHAVDAAVAITLCVGVVNPMSSGIGGGSFLIVSSQKDSKAEAFDMRETAPLAASKDM 158
297803126 161 YKNDASAKSLGALSMGVPGEIAGLYEAWKRYGRLSWKPLFEPAIELARGGFVVHPYLGKAISSHAAMILKDPGLRSVFSR 240
15233493  159 YKNDASAKSLGALSMGVPGEIAGLYEAWKRYGRLPWKPLFEPAIKLARDGFVVYPYLGKAISTKVAMILKDPGMRSVFSR 238
297803126 241 NGQVLKPGETCYNPELARSLETISEQGPGAFYNGTIGEKLVNDVKKAGGIITMDDLRSYEVLVTDAMSVDVMGYTIHGMP 320
15233493  239 NGQVLKTGETCYNPELAQSLETISEQGPGAFYNGTVGEKLVKDVKKAGGIITMDDLRSYKVRVTDAMSVDVMGYTVHGMP 318
297803126 321 PPSGGTLGFSMVIDILDSYSNLYTTSGSHLGLHRLIEAMKHMFAARMDLGDPGFVNITNAMNQMLSKTHAEEIRKRIFDN 400
15233493  319 PPSGGTVGFSMVMNILDSYSNLYTASGRELGLHRLIEAMKHMFAARMDLGDPEFVNVTNSMNQMLSKAHAEEIQKRIFDN 398
297803126 401 TTFPPEYYLNRWSQLRDQGTSHFCIVDADRNSVSMTSTVNYGFGAGVLSPSTGIVLNNEMDDFSVPAEITPDRLPPAPTN 480
15233493  399 TTFPPEYYMNRWSQLRDQGTSHFCVVDADRNSVSMTSTVNYRFGAGVLSPSTGIVLNNEMDDFSTPTEITPDMLPPAPTN 478
297803126 481 FIEPNKRPLSSMTPLVITKDGEFVAALGGAGGMHIIPAVLQVFLNCFVLNMKPKQAVESARIYHRLIPNVVSYENFTAIN 560
15233493  479 FIEPNKRPLSSMTPLVITKDGEFVAALGGAGGMHIIPAVLQVFLNCFVLNMKPKEAVESARIYHRLIPNVVSYENFTTIN 558
297803126 561 GDHIGVSEDTKMFLAGRGHELKAVSGGAIVQLIVQSFKEEKEEEMIIEIGRKIGKKSKPSKGLLTAVCDPRKDGKPAAV 639
15233493  559 GDHIGVSEDTKMFLAERGHELKELSGGAIVQLIVQSFKEEKEEEMIIEIGRKIGKKSKPLKGLLTAVSDPRKDGKPAAV 637
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap