Conserved Protein Domain Family
PLN02179

?
PLN02179: PLN02179 
carbonic anhydrase
Statistics
?
PSSM-Id: 177835
View PSSM: PLN02179
Aligned: 4 rows
Threshold Bit Score: 479.092
Threshold Setting Gi: 297804062
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15233471    1 MDTNAKTIFFMAMCFIYLSFPNISHAHS-EVDDETPFTYEQKTEKGPEGWGKINPHWKVCNTGRYQSPIDLTNERVSLIH 79 
15233474    1 MDANTKTILFFVVFFIDLFSPNILFVYArEIGNKPLFTYKQKTEKGPAEWGKLDPQWKVCSTGKIQSPIDLTDERVSLIH 80 
297804060   1 MDPNTKTIFFFVVFFMDLFFPNILLVYArEIGNKPLFTYKQKTEKGPAEWGKLNPQWKVCSTGKFQSPIDLTDERVSLIH 80 
297804062   1 MDPNAKTIFFLAMFFIYLSFPNISLAHT-EVDDETPFTYEQKTEKGPEGWGKINPQWKVCNTGRYQSPIDLTNERVSLIH 79 
15233471   80 DQAWTRQYKPAPAVITNRGHDIMVSWKGDAGKMTIRKTDFNLVQCHWHSPSEHTVNGTRYDLELHMVHTSARGRTAVIGV 159
15233474   81 DQALSKHYKPASAVIQSRGHDVMVSWKGDGGKITIHQTDYKLVQCHWHSPSEHTINGTSYDLELHMVHTSASGKTTVVGV 160
297804060  81 DQALSIHYKPALAVIQSRGHDVMVSWKEDAGKITIHQTDYKLVQCHWHSPSEHTINGTSYDLELHMVHTSASGKTAVVGV 160
297804062  80 DQAWTRQYKPAPAVITNRGHDIMVSWKGDAGKITIRKTDFKLVQCHWHSPSEHTVNGTSYDLELHMVHTSARGRTAVIGV 159
15233471  160 LYKLGEPNEFLTKLLNGIKAVGNKEINLGMIDPREIRFQTRKFYRYIGSLTVPPCTEGVIWTVVKRVntismeqitalrq 239
15233474  161 LYKLGEPDEFLTKILNGIKGVGKKEIDLGIVDPRDIRFETNNFYRYIGSLTIPPCTEGVIWTVQKRV------------- 227
297804060 161 LYKLGEPDEFLTKLLNGIKGVGKKEMNLGIVDPRDIRFETNNFYRYIGSLTIPPCTEGVIWTVEKRV------------- 227
297804062 160 LYRLGEPNEFLTKLLNGIKAVGNKEINLGMIDPREIRFQTRKFYRYIGSLTVPPCTEGVIWTVVKRVntisteqiaalre 239
15233471  240 avddgfetnsrpvqdskgrsVWFYDPNV 267
15233474  228 --------------------LYFFCFCY 235
297804060 228 ---------------------LYFSFQL 234
297804062 240 avddgfetnsrpvqdskgrsVWFYDPNV 267
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap