Conserved Protein Domain Family
PLN02178

?
PLN02178: PLN02178 
cinnamyl-alcohol dehydrogenase
Statistics
?
PSSM-Id: 177834
View PSSM: PLN02178
Aligned: 3 rows
Threshold Bit Score: 726.048
Threshold Setting Gi: 297821375
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15227091    1 MVDQNKAFGWAANDESGVLSPFHFSRRENGENDVTVKILFCGVCHSDLHTIKNHWGFSRYPIIPGHEIVGIATKVGKNVT 80 
15227106    1 MVDQNRAFGWAANDESGVLSPFHFSRRENGENDVTVKILFCGVCHSDLHTIKNHWGFSRYPIIPGHEIVGIATKVGKNVT 80 
297821375   1 MVDRNKAFGWAANDESGVLSPFHFSRRENCENDVTVKIFFCGVCHSDLHTIKNHWGISRYPVVPGHEIVGIATKVGKNVT 80 
15227091   81 KFKEGDRVGVGVIIGSCQSCESCNQDLENYCPKVVFTYNSRSSDGTsRNQGGYSDVIVVDHRFVLSIPDGLPSDSGAPLL 160
15227106   81 KFKEGDRVGVGVIIGSCQSCESCNQDLENYCPKVVFTYNSRSSDGT-RNQGGYSDVIVVDHRFVLSIPDGLPSDSGAPLL 159
297821375  81 KFKEGDRVGVGVIIGSCESCESCNQDLENYCPEVVFTYNSRSSDGT-RNQGGYSDVIVVDHRFVLSIPDGLPSDAGAPLL 159
15227091  161 CAGITVYSPMKYYGMTKESGKRLGVNGLGGLGHIAVKIGKAFGLRVTVISRSSEKEREAIDRLGADSFLVTTDSQKMKEA 240
15227106  160 CAGITVYSPMKYYGMTKESGKRLGVNGLGGLGHIAVKIGKAFGLRVTVISRSSEKEREAIDRLGADSFLVTTDSQKMKEA 239
297821375 160 CAGITVYSPMKYYGMAEESGKHLGVNGLGGLGHIAVKIGKAFGLRVTVMSRSSEKEREAIDRLGADSFLVTTDSQKMKDA 239
15227091  241 VGTMDFIIDTVSAEHALLPLFSLLKVNGKLVALGLPEKPLDLPIFSLVLGRKMVGGSQIGGMKETQEMLEFCAKHKIVSD 320
15227106  240 VGTMDFIIDTVSAEHALLPLFSLLKVSGKLVALGLLEKPLDLPIFPLVLGRKMVGGSQIGGMKETQEMLEFCAKHKIVSD 319
297821375 240 TGTIDFIIDTVSAEHALLPLFSLLKVSGKLVALGLPEKPLELPIFPLVLGRNMVGGSQIGGMKETQEMLEFCAKHNIVSD 319
15227091  321 IELIKMSDINSAMDRLAKSDVRYRFVIDVANSLLPESSAEILTEQVDHGVSITSRF 376
15227106  320 IELIKMSDINSAMDRLVKSDVRYRFVIDVANSLLPESSAEILTEHVDHGVSITSRF 375
297821375 320 IELIKMSDINSAMDRLAKSDVRYRFVIDVANSLVTDSSAENLEDHVDHEVSITSRF 375
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap