Conserved Protein Domain Family
PLN02175

?
PLN02175: PLN02175 
endoglucanase
Statistics
?
PSSM-Id: 177832
View PSSM: PLN02175
Aligned: 4 rows
Threshold Bit Score: 896.379
Threshold Setting Gi: 15219963
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297845318   1 MASPFFFVFlLLSALSLENTYASPNYREALSKSLLFFQGQRSGRLPGDQKLSWRSSSGLSDGSSAHVDLTGGYYDAGDNV 80 
15219963    1 MASPFFFVF-LLSALSLENTYASPNYREALSKSLLFFQGQRSGRLPSDQQLSWRSSSGLSDGSSAHVDLTGGYYDAGDNV 79 
15217446    1 MTSLFFFVL-LFSSLLISNGDANPNYKEALSKSLLFFQGQRSGPLPRGQQISWRASSGLSDGSAAHVDLTGGYYDAGDNV 79 
297841905   1 MTSPFFFVF-LFSSLLIGNVDANPNYKEALSKSLLFFQGQRSGPLPRGQQLSWRASSGLSDGSAAHVDLTGGYYDAGDNV 79 
297845318  81 KFNFPMAFTTTMLSWSSLEYGKKMGSELQNSRVAIRWATDYLLKCARATPGKLYVGVGDPNGDHKCWERPEDMDTPRTVY 160
15219963   80 KFNFPMAFTTTMLSWSSLEYGKKMGPELQNSRVAIRWATDYLLKCARATPGKLYVGVGDPNGDHKCWERPEDMDTPRTVY 159
15217446   80 KFNLPMAFTTTMLSWSALEYGKRMGPELENARVNIRWATDYLLKCARATPGKLYVGVGDPNVDHKCWERPEDMDTPRTVY 159
297841905  80 KFNFPMAFTTTMLSWSALEYGKRMGPELENARVNIRWATDYLLKCARATPGKLYVGVGDPNVDHKCWERPEDMDTPRTVY 159
297845318 161 SVSSSNPGSDVAAETAAALAASSMVFRKVDPKYSRLLLATAKKVMQFAIQYRGAYSDSLSSSVCPFYCSYSGYKDELVWG 240
15219963  160 SVSPSNPGSDVAAETAAALAASSMVFRKVDPKYSRLLLATAKKVMQFAIQYRGAYSNSLSSSVCPFYCSYSGYKDELLWG 239
15217446  160 SVSASNPGSDVAAETAAALAAASMVFRKVDSKYSRLLLATAKDVMQFAIQYQGAYSDSLSSSVCPFYCSYSGYKDELMWG 239
297841905 160 SVSPSNPGSDVAAETAAALAAASMVFRKVDSKYSRLLLATAKNVMQFAIQYRGAYSDSLSSSVCPFYCSYSGYKDELMWG 239
297845318 241 AAWLHRATNDPYYTNFIKSLGGGDQPDIFSWDNKYAGAYVLLSRRAVLNKDNNFEPYKQAAENFMCKILPNSPSSSTKYT 320
15219963  240 AAWLHRATNDPYYTNFIKSLGGGDQPDIFSWDNKYAGAYVLLSRRAVLNKDNNFELYKQAAENFMCKILPNSPSSSTKYT 319
15217446  240 ASWLLRATNNPYYANFIKSLGGGDQPDIFSWDNKYAGAYVLLSRRALLNKDSNFEQYKQAAENFICKILPDSPSSSTQYT 319
297841905 240 ASWLLRATNDPYYANFIKSLGGGDQPDIFSWDNKYAGAYVLLSRRALLNKDSNFEQYKQAAENFICKILPDSPSSSTQYT 319
297845318 321 KGGLMYKLPQSNLQYVTSITFLLTTYAKYMKSTKHTFNCGNSLIVPNALINLSKRQVDYILGVNPLKMSYMVGFSSNFPK 400
15219963  320 KGGLMYKLPQSNLQYVTSITFLLTTYAKYMKSTKQTFNCGNSLIVPNALINLSKRQVDYVLGVNPMKMSYMVGFSSNFPK 399
15217446  320 QGGLMYKLPQSNLQYVTSITFLLTTYAKYMKATKHTFNCGSSVIVPNALISLSKRQVDYILGDNPIKMSYMVGFSSNFPK 399
297841905 320 QGGLMYKLPQSNLQYVTSITFLLTTYAKYMKSTKHTFNCGNSVIVPNALISLSKRQVDYILGDNPIKMSYMVGFGSNFPK 399
297845318 401 RIHHRGSSLPSRAVRSNSLGCNGGFQSFRTQNPNPNILTGAIVGGPNQNDEYPDQRDDYTRSEPATYINAAFVGPLAYFA 480
15219963  400 RIHHRGSSLPSRAVRSNSLGCNGGFQSFRTQNPNPNILTGAIVGGPNQNDEYPDQRDDYTRSEPATYINAAFVGPLAYFA 479
15217446  400 RIHHRASSLPSHALRSQSLGCNGGFQSFYTQNPNPNILTGAIVGGPNQNDGYPDQRDDYSHAEPATYINAAFVGPLAYFA 479
297841905 400 RIHHRASSLPSHALHSHSLGCNGGFQSFYTQNPNPNILTGAIVGGPNQNDGYPDQRDDYSHAEPATYINAAFVGPLAYFA 479
297845318 481 AGRSP 485
15219963  480 ASRSP 484
15217446  480 AGRST 484
297841905 480 AGRSA 484
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap