Conserved Protein Domain Family
PLN02174

?
PLN02174: PLN02174 
aldehyde dehydrogenase family 3 member H1
Statistics
?
PSSM-Id: 177831
View PSSM: PLN02174
Aligned: 4 rows
Threshold Bit Score: 890.935
Threshold Setting Gi: 297852202
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30693800    1 MAAKKVFGSAEASNLVTELRRSFDDGVTRGYEWRVTQLKKLMIICDNHEPEIVAALRD------------DLGKPELESS 68 
15219358    1 MAAKKVFGSAEASNLVTELRRSFDDGVTRGYEWRVTQLKKLMIICDNHEPEIVAALRD------------DLGKPELESS 68 
297841449   1 MAAKKMFGAADASILVTDLRRSFDDGVTRGYEWRVTQLKKLLIICDNHEPEIVAALRD------------DLGKPELESS 68 
297852202   1 MAAKKMFGAADASILVTGLSRSFDDGVTR---VTLKRISQTSIIGLTYPPTWSVSLLSmtivatsmmlcvDTCTTQLQCN 77 
30693800   69 VYE----VSLLRNSIKLALKQLKNWMAPEKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSIDPVIGAISAGNAVV 144
15219358   69 VYE----VSLLRNSIKLALKQLKNWMAPEKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSIDPVIGAISAGNAVV 144
297841449  69 VYE----VSLLRNSIKLALKQLKNWMAPEKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSIDPVIGAISAGNAVV 144
297852202  78 FFDklrvVSLLRNSIKLALKQLKNWMAPEKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSIDHVIGAISAGNAVV 157
30693800  145 LKPSELAPASSALLTKLLEQYLDPSAVRVVEGAVTETSALLEQKWDKIFYTGSSKIGRVIMAAAAKHLTPVVLELGGKSP 224
15219358  145 LKPSELAPASSALLTKLLEQYLDPSAVRVVEGAVTETSALLEQKWDKIFYTGSSKIGRVIMAAAAKHLTPVVLELGGKSP 224
297841449 145 LKPSELAPASSALLAKLMEQYLDSSAVRVVEGAVTETTALLEQKWDKIFYTGSSKIGHVIMAAAAKHLTPVVLELGGKSP 224
297852202 158 LKPSELAPASSALLAKLLEQYLDSSVVRVVEGAVTETTALLEQKWDKIFYTGSSKIGRVIMAAAAKRLTPVVLELGGKSP 237
30693800  225 VVVDSDTDLKVTVRRIIVGKWGCNNGQACVSPDYILTTKEYAPKLIDAMKLELEKFYGKNPIESKDMSRIVNSNHFDRLS 304
15219358  225 VVVDSDTDLKVTVRRIIVGKWGCNNGQACVSPDYILTTKEYAPKLIDAMKLELEKFYGKNPIESKDMSRIVNSNHFDRLS 304
297841449 225 VVVDSDTDLKVTVRRIIAGKWGCNNGQACISPDYILTTKEYAPKVIDAMKKELETFYGKNPMESKDMSRIVNSTHFDRLS 304
297852202 238 VVVDSDTDLKVTVRRIIAGKWGCNNGQACISPDYILTTKEYAPKVIDAMKKELETFYGKNPMESKDMSRIVNSTHFDRLS 317
30693800  305 KLLDEKEVSDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAAYLFTHNK 384
15219358  305 KLLDEKEVSDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAAYLFTHNK 384
297841449 305 KMLDEKEVSDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAAYLFTHNK 384
297852202 318 KLLDEKEVSDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEENIWP-----SPSNSHESFDMIRSRPKPLAAYLFTHNK 392
30693800  385 KLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRL 464
15219358  385 KLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRL 464
297841449 385 KLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRL 464
297852202 393 KLKERFATTVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPYSRGKLRL 472
30693800  465 LKALVDSNIFDLFKVLLGLA 484
15219358  465 LKALVDSNIFDLFKVLLGLA 484
297841449 465 LKALVDSNIFDIFKVLLGLS 484
297852202 473 LKALVDSNIFDIFKALLGLS 492
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap