Conserved Protein Domain Family
PLN02173

?
PLN02173: PLN02173 
UDP-glucosyl transferase family protein
Statistics
?
PSSM-Id: 177830
View PSSM: PLN02173
Aligned: 5 rows
Threshold Bit Score: 968.731
Threshold Setting Gi: 297824377
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15224372    1 MEKMRGHVLAVPFPSQGHITPIRQFCKRLHSKGFKTTHTLTTFIFNTIHLDPSSPISIATISDGYDQGGFSSAGSVPEYL 80 
15224368    1 MEHKRGHVLAVPYPTQGHITPFRQFCKRLHFKGLKTTLALTTFVFNSINPDLSGPISIATISDGYDHGGFETADSIDDYL 80 
42571217    1 MEKMRGHVLAVPFPSQGHITPIRQFCKRLHSKGFKTTHTLTTFIFNTIHLDPSSPISIATISDGYDQGGFSSAGSVPEYL 80 
297824375   1 ---MEGHVLAVPYPTQGHITPIRQFCKRLHSKGLKTTLALTTFVFNSIKPDLSGPISIATISDGYDHGGFESAGSIADYL 77 
297824377   1 MEKMRGHVLAVPFPSQGHITPIRQFCKRLHSKGFKTTHTLTSFIFNTIHLDPSSPISIATISDGYDQGGFSSAGSVPEYL 80 
15224372   81 QNFKTFGSKTVADIIRKHQSTDNPITCIVYDSFMPWALDLAMDFGLAAAPFFTQSCAVNYINYLSYINNGSLTLPIKDLP 160
15224368   81 KDFKTSGSKTIADIIQKHQTSDNPITCIVYDAFLPWALDVAREFGLVATPFFTQPCAVNYVYYLSYINNGSLQLPIEELP 160
42571217   81 QNFKTFGSKTVADIIRKHQSTDNPITCIVYDSFMPWALDLAMDFGLAAAPFFTQSCAVNYINYLSYINNGSLTLPIKDLP 160
297824375  78 ENFKTSGSKTIADIIRKHQTSDSPITCIVYDAFMPWALDVAREFGLVATPFFTQPCAVNYVYYLSYINNGSLKLPIEDLP 157
297824377  81 QNFKTFGSKTVADVIRKHQSTDNPITCIVYDSFMPWALDLAREFGLAAAPFFTQSCAVNYINYLSYINNGRLTLPIKDLP 160
15224372  161 LLELQDLPTFVTPTGSHLAYFEMVLQQFTNFDKADFVLVNSFHDLDLHEEELLSKVCPVLTIGPTVPSMYLDQQIKSDND 240
15224368  161 FLELQDLPSFFSVSGSYPAYFEMVLQQFINFEKADFVLVNSFQELELHENELWSKACPVLTIGPTIPSIYLDQRIKSDTG 240
42571217  161 LLELQDLPTFVTPTGSHLAYFEMVLQQFTNFDKADFVLVNSFHDLDLHVKELLSKVCPVLTIGPTVPSMYLDQQIKSDND 240
297824375 158 FLELQDLPSFFSVSGSYPAYFEMVLQQFINFEKADFVLVNSFQELELHENALWSKACPVLTIGPTIPSIYLDQRIESDTD 237
297824377 161 LLELQDLPTFVTPTGSHLAYFEMVLQQFTNFDKADFVLVNSFHDLDLQEEELLSKVCPVLTIGPTVPSMYLDQQIKFDND 240
15224372  241 YDLNLFDLKEAALCTDWLDKRPEGSVVYIAFGSMAKLSSEQMEEIASAISNFSYLWVVRASEESKLPPGFLETVDKDKSL 320
15224368  241 YDLNLFESKDDSFCINWLDTRPQGSVVYVAFGSMAQLTNVQMEELASAVSNFSFLWVVRSSEEEKLPSGFLETVNKEKSL 320
42571217  241 YDLNLFDLKEAALCTDWLDKRPEGSVVYIAFGSMAKLSSEQMEEIASAISNFSYLWVVRASEESKLPPGFLETVDKDKSL 320
297824375 238 YDLNLIESKDDSFCTNWLDTRPQGSVVYVAFGSMAQLTNEQMEELASAVSNFSFLWVVRSSEEAKLPSGFLDTVNKDKSL 317
297824377 241 YDLNLFDLKEAALCTDWLDKRPQGSVVYIAFGSMAKLSSEQMEEIASAISNFSYLWVVRASEESKLPPGFLETVDKDKSL 320
15224372  321 VLKWSPQLQVLSNKAIGCFMTHCGWNSTMEGLSLGVPMVAMPQWTDQPMNAKYIQDVWKVGVRVKAEKESGICKREEIEF 400
15224368  321 VLKWSPQLQVLSNKAIGCFLTHCGWNSTMEALTFGVPMVAMPQWTDQPMNAKYIQDVWKAGVRVKTEKESGIAKREEIEF 400
42571217  321 VLKWSPQLQVLSNKAIGCFMTHCGWNSTMEGLSLGVPMVAMPQWTDQPMNAKYIQDVWKVGVRVKAEKESGICKREEIEF 400
297824375 318 VLKWSPQLQVLSNKAIGCFLTHCGWNSTMEALTFGVPMVAMPQWTDQPMNAKYIQDVWKAGVRVKTEKESGIAKREEIEF 397
297824377 321 VLKWSPQLQVLSNKAIGCFMTHCGWNSTMEGLSLGVPMVAMPQWTDQPMNAKYIQDVWKVGVRVKAEKESGIAKREEIEL 400
15224372  401 SIKEVMEGEKSKEMKENAGKWRDLAVKSLSEGGSTDININEFVSKIQIK 449
15224368  401 SIKEVMEGERSKEMKKNVKKWRDLAVKSLNEGGSTDTNIDTFVSRVQSK 449
42571217  401 SIKEVMEGEKSKEMKENAGKWRDLAVKSLSEGGSTDININEFVSKIQIK 449
297824375 398 SIREVMEGERSKEMKKNVKKWRDLALKSLNEGGSTDINIDTFVSRVQSK 446
297824377 401 SIKEVMEGEKSKEMKENAGNWRDLAVKSLSEGGSTYININAFVSKIQIK 449
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap