Conserved Protein Domain Family
PLN02169

?
PLN02169: PLN02169 
fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase
Statistics
?
PSSM-Id: 177826
View PSSM: PLN02169
Aligned: 2 rows
Threshold Bit Score: 981.418
Threshold Setting Gi: 15223657
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297853618   1 MAMLGlleLFVAFLFSLVFLFTCFFIHKKPHGQPILKNWPFLGMLPGMLPQIPRIYDWTVEVLEASNLTFYFKGPWLSGT 80 
15223657    1 MAMLG---FYVTFIFFLVCLFTYFFLQKKPQGQPILKNWPFLRMLPGMLHQIPRIYDWTVEVLEATNLTFYFKGPWLSGT 77 
297853618  81 DMLFTADPKNINHILSSNFGNYPKGPEFKKIFDVLGEGILTVDLELWEDLRKSNHAMFHNQDFLELSLSSNKSKLKEGLV 160
15223657   78 DMLFTADPRNIHHILSSNFGNYPKGPEFKKIFDVLGEGILTVDFELWEEMRKSNHALFHNQDFIELSVSSNKSKLKEGLV 157
297853618 161 PFLDNAAHENIIIDLQDVFMRFMFDTSSILMTGYDPMSLSIEMLEVEFGEAADIGEEAIYYRHFKPVMLWRLQNWLGIGL 240
15223657  158 PFLDNAAQKNIIIELQDVFQRFMFDTSSILMTGYDPMSLSIEMLEVEFGEAADIGEEAIYYRHFKPVILWRLQNWIGIGL 237
297853618 241 ERKMRTALATVNRMFAKIISSRRKEEISRGETEP-SKDALTYYMNVDTTKYKLLKPKNDTFIRDVIFSLVLAGRDTTSSA 319
15223657  238 ERKMRTALATVNRMFAKIISSRRKEEISRAKTEPySKDALTYYMNVDTSKYKLLKPNKDKFIRDVIFSLVLAGRDTTSSV 317
297853618 320 LTWFFWLLSKNPQVMAKIRHEINTKYDPEDLEKLVYLHAALSESMRLYPPLPFNHKAPAKPDVLPSGHKVEPESKIVICI 399
15223657  318 LTWFFWLLSKHPQVMAKLRHEINTKFDNEDLEKLVYLHAALSESMRLYPPLPFNHKSPAKPDVLPSGHKVDANSKIVICI 397
297853618 400 YALGRMRSVWGEDASDFKPERWISDNGGLRHEPSYKYVAFNSGPRTCLGKHLALLQMKIVALEIIKNYDFKVIEGHKIEA 479
15223657  398 YALGRMRSVWGEDALDFKPERWISDNGGLRHEPSYKFMAFNSGPRTCLGKNLALLQMKMVALEIIRNYDFKVIEGHKVEP 477
297853618 480 IPSILLRMKHGLKVTVTKKM 499
15223657  478 IPSILLRMKHGLKVTVTKKI 497
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap