Conserved Protein Domain Family
PLN02166

?
PLN02166: PLN02166 
dTDP-glucose 4,6-dehydratase
Statistics
?
PSSM-Id: 165812
View PSSM: PLN02166
Aligned: 6 rows
Threshold Bit Score: 922.872
Threshold Setting Gi: 145339456
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225439840   1 MKQLHKQSSvNHRRDEEIPTSQSPPYSPKTLKHPRSLPRSINYLFKEQRLLFILVGILIGSTFFIVQPSLSRLGPAETRS 80 
145361853   1 MKQLHKQMS-SKRDEETIPMSQSSPYSPKTLKHPRSLPRSLHYLFREQRLLFILVGILIGSTFFILQPSLSRLGAAESTS 79 
145339456   1 MKQLHKQMS-SKRDEETIPMSQSSPYSPKTLKHPRSLPRSLHYLFREQRLLFILVGILIGSTFFILQPSLSRLGAAESTS 79 
224140115   2 MKQLHKQTSvNHRRDEEIPTAQS--YSPKMLKHPRSLPRSINYLFKEQRLLFILVGILIGSTFFIFQPTLSRLNPSDPTT 79 
225439842   1 MKQLHKQSSvNHRRDEEIPTSQSPPYSPKTLKHPRSLPRSINYLFKEQRLLFILVGILIGSTFFIVQPSLSRLGPAETRS 80 
297816652   1 MKQLHKQMS-SKRDEETIPMSQSSPYSPKTLKHPRSLPRSLHYLFREQRLLFILVGILIGSTFFILQPSLSRLGAAESTS 79 
225439840  81 TIPRSVTIGVTSRDQISIPYPQSNGAGKVGRIPVGIGRRRLRIVVTGGAGFVGSHLVDKLIARGDDVIVIDNFFTGRKEN 160
145361853  80 LITRSVSYAVTDSPPSRSTFNSGGGGGRTGRVPVGIGRKRLRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKEN 159
145339456  80 LITRSVSYAVTDSPPSRSTFNSGGGGGRTGRVPVGIGRKRLRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKEN 159
224140115  80 HSSLSSSIYPRNQDSSSGSSRFFSKRTFPGRVPAGIGRKSLRIVVTGGAGFVGSHLVDKLISRGDEVIVIDNFFTGRKEN 159
225439842  81 TIPRSVTIGV-------------------GRIPVGIGRRRLRIVVTGGAGFVGSHLVDKLIARGDDVIVIDNFFTGRKEN 141
297816652  80 LITRSVSYAVSDSPPSMKTFN-SGGGGRTGRVPVGIGRKRLRIVVTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKEN 158
225439840 161 VMHHFGNPRFELIRHDVVEPILLEVDQIYHLACPASPVHYKYNPVKTIKTNVMGTLNMLGLAKRIGARFLLTSTSEVYGD 240
145361853 160 LVHLFSNPRFELIRHDVVEPILLEVDQIYHLACPASPVHYKYNPVKTIKTNVMGTLNMLGLAKRVGARFLLTSTSEVYGD 239
145339456 160 LVHLFSNPRFELIRHDVVEPILLEVDQIYHLACPASPVHYKYNPVKTIKTNVMGTLNMLGLAKRVGARFLLTSTSEVYGD 239
224140115 160 LVHLFGNPRFELIRHDVVEPILLEVDQIYHLACPASPVHYKYNPVKTIKTNVMGTLNMLGLAKRVGARFLLTSTSEVYGD 239
225439842 142 VMHHFGNPRFELIRHDVVEPILLEVDQIYHLACPASPVHYKYNPVKTIKTNVMGTLNMLGLAKRIGARFLLTSTSEVYGD 221
297816652 159 LVHLFSNPRFELIRHDVVEPILLEVDHIYHLACPASPVHYKYNPVKTIKTNVMGTLNMLGLAKRVGARFLLTSTSEVYGD 238
225439840 241 PLEHPQKETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGAEVEVRIARIFNTYGPRMCIDDGRVVSNFVAQAIRRQPLT 320
145361853 240 PLEHPQKETYWGNVNPIGERSCYDEGKRTAETLAMDYHRGAGVEVRIARIFNTYGPRMCLDDGRVVSNFVAQTIRKHPMT 319
145339456 240 PLEHPQKETYWGNVNPIGERSCYDEGKRTAETLAMDYHRGAGVEVRIARIFNTYGPRMCLDDGRVVSNFVAQTIRKHPMT 319
224140115 240 PLEHPQKETYWGNVNPIGERSCYDEGKRTAETLAMDYHRGADVEVRIARIFNTYGPRMCLDDGRVVSNFVAQVIRKQPMT 319
225439842 222 PLEHPQKETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGAEVEVRIARIFNTYGPRMCIDDGRVVSNFVAQAIRRQPLT 301
297816652 239 PLEHPQKETYWGNVNPIGERSCYDEGKRTAETLAMDYHRGAGVEVRIARIFNTYGPRMCLDDGRVVSNFVAQTIRKHPMT 318
225439840 321 VYGDGKQTRSFQYVSDLVDGLVALMEGEHVGPFNLGNPGEFTMLELAEVVKETIDSSATIEFKPNTADDPHKRKPDISRA 400
145361853 320 VYGDGKQTRSFQYVSDLVEGLVALMENDHVGPFNLGNPGEFTMLELAEVVKEVIDPSATIEFKPNTADDPHKRKPDISKA 399
145339456 320 VYGDGKQTRSFQYVSDL--GLVALMENDHVGPFNLGNPGEFTMLELAEVVKEVIDPSATIEFKPNTADDPHKRKPDISKA 397
224140115 320 VYGDGKQTRSFQYVSDLVDGLVALMEGEHVGPFNLGNPGEFTMLELAEVVKETIDSSATIEFKPNTADDPHKRKPDISKA 399
225439842 302 VYGDGKQTRSFQYVSDLVDGLVALMEGEHVGPFNLGNPGEFTMLELAEVVKETIDSSATIEFKPNTADDPHKRKPDISRA 381
297816652 319 VYGDGKQTRSFQYVSDLVEGLVALMENDHVGPFNLGNPGEFTMLELAEVVKEVIDPSATIEFKPNTADDPHKRKPDISKA 398
225439840 401 KELLNWEPKISLREGLPLMVSDFQNRILNEDEGKGQ 436
145361853 400 KEQLNWEPKISLREGLPRMVSDFRNRILNEDEGKGL 435
145339456 398 KEQLNWEPKISLREGLPRMVSDFRNRILNEDEGKGL 433
224140115 400 KELLNWEPRISLREGLPLMVNDFRNRILNGDEGKGL 435
225439842 382 KELLNWEPKISLREGLPLMVSDFQNRILNEDEGKGQ 417
297816652 399 KELLNWEPKISLREGLPRMVSDFRNRILNEDEGKGL 434
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap