Conserved Protein Domain Family
PLN02165

?
PLN02165: PLN02165 
adenylate isopentenyltransferase
Statistics
?
PSSM-Id: 177823
View PSSM: PLN02165
Aligned: 9 rows
Threshold Bit Score: 522.85
Threshold Setting Gi: 297803646
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15222583    1 MQQLMTLL------------------------SPPLSHSSLlptVTTKFGSPRL------VTTCMGHAGrKNIKDKVVLI 50 
15221410    1 MTELNFHLlpiisdrfttttttspsfsshsssSSSLLSFTK---RRRKHQPLVS------SIRMEQSRS-RNRKDKVVVI 70 
15230294    1 MQNLTSTFv-----------------------SPSMIPITS---PRLRLPPPRS------VVPMTTVCMeQSYKQKVVVI 48 
15233904    1 ----------------------------------------------------------------------MKCNDKMVVI 10 
255572084   1 ---MKFSFfnlth--------------hshytPPPLLPVTIikpTRRKSPPRWV------RMDSSSPSPpKQQKDKIVVI 57 
224099381   1 ---MKIPFpkstnqp-----------lytalkTQPLHPINIsipFNKPRPPPIAvrmdtdSSTTTSTAVyRHKKDKILVI 66 
297841567   1 MTELNFLLlpiisdrftt----tttspsfsshSSSLLSFTK---RRRKHQPLVS------SIRMEQSQS-QNRKDKVVVI 66 
297834830   1 MQNLTSTFv-----------------------SRSIVPITS---PRLRLPPPRS------VVPMTTVCMeQSSKQKVVVI 48 
297803646   1 ----------------------------------------------------------------------MNCKDKMVVI 10 
15222583   51 TGTTGTGKSRLSVDLATRfFPAEIINSDKMQIYKGFEIVTNLIPLHEQGGVPHHLLGQFHPQDGELTPAEFRSLATLSIS 130
15221410   71 LGATGAGKSRLSVDLATR-FPSEIINSDKIQVYEGLEITTNQITLQDRRGVPHHLLGVINPEHGELTAGEFRSAASNVVK 149
15230294   49 MGATGSGKSCLSIDLATR-FSGEIVNSDKIQFYDGLKVTTNQMSILERCGVPHHLLGELPPDDSELTTSEFRSLASRSIS 127
15233904   11 MGATGSGKSSLSVDLALH-FKAEIINSDKMQFYDGLKITTNQSTIEDRRGVPHHLLGELNPEAGEVTAAEFRVMAAEAIS 89 
255572084  58 MGATGCGKTRLSIDLATR-FQSEIINTDKMQVYKGLDITTNKITLQDRLGVPHHLLGEVDPDNCEFSPSDFRLHAGLSIS 136
224099381  67 MGATGCGKTRVSIDLATR-FQSEIINSDKMQVYEGLDITTNKITIQDRLGVPHHLLGEFDPDDGELTPSEYRLAGGLAIS 145
297841567  67 LGATGAGKSRLSVDLATR-FPSEIINSDKIQVYEGLEITTNQITLPDRRGVPHHLLGVLNPEHGELTAGEFRSAASNVVK 145
297834830  49 MGATGSGKSRLSIDLATR-FSGEVVNSDKIQFYNGLKVTTNQMSIPERCGVPHHLLGELPPDDSELTTSEFRSLASRSIS 127
297803646  11 MGATGSGKSSLSVDLALH-FKAEIINSDKMQFYDGLKITTNQSTISDRRGVPHHLLGELNPEAGEVTAAEFRVMAAKAIS 89 
15222583  131 KLISSKKLPIVVGGSNSFNHALLAERFDPDIDPFSPGSSLstICSDLRYKCCILWVDVLEPVLFQHLCNRVDQMIESGLV 210
15221410  150 EITSRQKVPIIAGGSNSFVHALLAQRFDPKFDPFSSGSCL--ISSDLRYECCFIWVDVSETVLYEYLLRRVDEMMDSGMF 227
15230294  128 EITARGNLPIIAGGSNSFIHALLVDRFDPKTYPFSSETS---ISSGLRYECCFLWVDVSVSVLFEYLSKRVDQMMESGMF 204
15233904   90 EITQRKKLPILAGGSNSYIHALLAKSYDPENYPFSDHKGS--ICSELKYDCCFIWIDVDQSVLFEYLSLRLDLMMKSGMF 167
255572084 137 DIVSRQKLPLLVGGSNSYIHALLVDRFNPEINVFQQSKNSesVSTQLRYDCCFIWVDVSLPLLCDYLCKRVDEMLDSGMF 216
224099381 146 GIVSRQNLPIVVGGSNSLIHALVVDRFNPELNVFDGCNP---VSTQLRYNCCFLWVDVSLPVLCDYLCKRVDEMLDSGML 222
297841567 146 EITTRQKLPIIAGGSNSFVHAVLAQRFDPKIDPFSSGSGL--ISSDLRYKCCFIWVDVSETVLYDYLLKRVDEMMDSGMF 223
297834830 128 EITARGNLPIVAGGSNSFIHALLVDRFDPQTYPFSSEVS---ISSNLRYECCFLWVDVSVSVLFEYLSKRVDQMMESGMF 204
297803646  90 EITQRKTLPILAGGSNSYIHALLAKSYDPENYPFSDHKGS--ICSELKYDCCFIWIDVDQPVLFEYLSLRLDMMMKSGMF 167
15222583  211 EQLAELYDPVVDSGRR--LGVRKTIGVEEFDRYFRVYPKEM--DKGI-----W-DLARKAAYEETVKGMKERTCRLVKKQ 280
15221410  228 EELSRFYDPVKSGLETr-FGIRKAIGVPEFDGYFKEYPPEK--KMIK-----W-DALRKAAYDKAVDDIKRNTWTLAKRQ 298
15230294  205 EELAGFYDPRYSGSAIraHGIHKTIGIPEFDRYFSLYPPERkqKMSE-----W-DQARKGAYDEAVQEIKENTWRLAKKQ 278
15233904  168 EEIAEFHRSKKAPKEP--LGIWKAIGVQEFDDYLKMYKWDN--DMDK-----W-DPMRKEAYEKAVRAIKENTFQLTKDQ 237
255572084 217 EELSEYYASVNPESQP---GLRKAIGVPEFDRYFKKYPPGY--QGGK-----W-DFVQRGVYEEAVRMIKENTCQLAKRQ 285
224099381 223 DELSEYYGSVDAASQI---GLRKAIGVPEFDRYFKKYPPGS--GCGRgigveW-DRVRRGVYEVCVREIKENTCQLAKRQ 296
297841567 224 EELSGFYDPVKSGLKPr-FGIRKAIGVPEFDGYFKEYPPE---KMIK-----WdDALRKAAYDKAVEDIKRNTWTLAKRQ 294
297834830 205 EELAGFYNPRYSGSTIrtHGIHKTIGIPEFDRYFSLYPPENnhKMPE-----W-DQARKAAYEEAVQEIKENTWRLAKKQ 278
297803646 168 EEIAEFHRAKKAPKEP--LGLWKAIGVQEFDDYLKKYKWDD--DMDK-----W-DTMRKEAYEKAVRAIKENTFQLTKDQ 237
15222583  281 KEKIMKLIRGGWEIKRLDATAAIMAELNqs----tAKGEGKNGREIWEKHIVDESVEIVKKFLLEV 342
15221410  299 VKKIEMLKDAGWEIERVDATASFKAVMM-------KSSSEKKWRENWEEQVLEPSVKIVKRHLVQN 357
15230294  279 IERIMKLKSSGWDIQRLDATPSFG----------------RSSREIWDNTVLDESIKVVKRFLVKD 328
15233904  238 ITKINKLRNAGWDIKKVDATASFREAIRaa---keGEGVAEMQRKIWNKEVLEPCVKIVRSHLDQP 300
255572084 286 MGKILRLKSAGWDLHRK------------------KRKKKKKWMEIWERDVLKPSMKIVNHFLDE- 332
224099381 297 IGKILRLKGAGWDLKRVDATESFREVMTvtsddhiKKRKKKRWMEVWGRDVMEPSMKIVKRFLEEE 362
297841567 295 IKKIEMLKDAGWEIERVDATASFKAVMM-------KSSSEKKWREIWEEQVLEPSVKIVNRHLVED 353
297834830 279 IERIVKLKSSGWDIQRLDATPSFR----------------RSSREIWDKTVLDESVKVVKRFLVKD 328
297803646 238 IKKIDKLRNAGWDIKKVYATASFREAIRaa---keGEGVADMQRKIWNKEVLEPCVKIVKSHLDQP 300
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap