Conserved Protein Domain Family
PLN02164

?
PLN02164: PLN02164 
sulfotransferase
Statistics
?
PSSM-Id: 177822
View PSSM: PLN02164
Aligned: 7 rows
Threshold Bit Score: 667.008
Threshold Setting Gi: 297844812
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297840475   2 SFSNPLslspMESHTTVPSNHEAETEPTEFEKNQKRYKDLIATFPHTKGWRPKGPLIEYHGCWFVQPLLEGCLHAQEFFQ 81 
15221130    1 MESETLtakaTITTTTLPSHDETKTESTEFEKNQKRYQDLISTFPHEKGWRPKEPLIEYGGYWWLPSLLEGCIHAQEFFQ 80 
15221131    1 MESKTT------------QNGSEVVELTEFEKTQKKYQDFIATLPKSKGWRPDEILTQYGGHWWQECLLEGLFHAKDHFE 68 
15221820    1 MESKTI----NDVVVSESNHELASSSPSEFEKNQKHYQEIIATLPHKDGWRPKDPFVEYGGHWWLQPLLEGLLHAQKFFK 76 
297844812   1 MEAKTI----NDAVVSESNHELAFSSPSEFEKNQKHYQEIIAKLPHKDGWRPKDPFVEYGGHWWLQPLLEGLLHAQNFFK 76 
297842165   1 MESKTT------------QNGSEVVELTEFEKTQKKYHDFIATLPKSKGWRPDEILTQYGGHWWQECLLEGLFHAKDHFE 68 
297839289   1 MESETL----NVTTTTVQSHDETKTESTKFEKNQKRYQELISTFPHEKGWRPKEPLIEYGGYWWLPPLLEGCIHAQEFFQ 76 
297840475  82 ARPIDFLICSSAKTGTTWLKALTFAIVNRTCLDNSSNPLLKRNPHELVPFIENEFAFFPQVDVIKDKGNTLFSTHIPYGL 161
15221130   81 ARPSDFLVCSYPKTGTTWLKALTFAIANRSRFDDSSNPLLKRNPHEFVPYIEIDFPFFPEVDVLKDKGNTLFSTHIPYEL 160
15221131   69 ARPTDFLVCSYPKTGTTWLKALTYAIVNRSRYDDAANPLLKRNPHEFVPYVEIDFAFYPTVDVLQDRKNPLFSTHIPNGL 148
15221820   77 ARPNDFFVCSYPKTGTTWLKALTFAIANRSKFDVSTNPLLKRNPHEFVPYIEIDFPFFPSVDVLKDEGNTLFSTHIPYDL 156
297844812  77 ARPNDFFVCSYPKTGTTWLKALTFAIANRSKFDDSTNPLLKRNPHEFVPYIEIDFPFFPSVDVLKDQGNTLFSTHIPYDL 156
297842165  69 ARPTDFLVCSYPKTGTTWLKALTYAIVNRSRYDEATNPLLKRNPHEFVPYVEIDFAFYPTVNVLQDRKNPLFSTHIPNGL 148
297839289  77 ARPSDFLVCSYPKTGTTWLKALTFAIANRSRFDDSSNPLLKRNPHEFVPYIEIDFPFFPEVDVLKDKGNTLFSTHIPYEL 156
297840475 162 LPKSIANSGCKMVYIWRDPKDTFISMWTFFQKQRSDFGPLNSLEESFDMFCRGTSVYGPYLDHVLGYWKAYQENPNQILF 241
15221130  161 LPDSVVKSGCKMVYIWREPKDTFISMWTFLHKERTELGPVSNLEESFDMFCRGLSGYGPYLNHILAYWKAYQENPDRILF 240
15221131  149 LPDSIVNSGCKMVYIWRDPKDTFISMWTFLHKEKSQEGQLASLEDSFDMFCKGLSVYGPYLDHVLGYWKAYQENPDRILF 228
15221820  157 LPESVVKSGCKIVYIWRDPKDTFVSMWTFAHKERSQQGPVVSIEEAFDKYCQGLSAYGPYLDHVLGYWKAYQANPDQILF 236
297844812 157 LPESVVKSGCKIVYIWRDPKDTFVSMWTFAHKERSQQGSLICLEEAFDKYCQGLSAYGPYLDHVLGYWKAYEANPNQILF 236
297842165 149 LPDSIVNSGCKMVYIWRDPKDTFISMWTFLHKEKSQEGQLASLEESFDMFCKGLSVYGPYLDHVLGYWKAYQENPDRILF 228
297839289 157 LPDSVVKSGCKMVYIWREPKDTFISMWTFLHKERTELGPVNNLEESFDMFCRGLSGYGPYLDHILAYWKAYQENPDRILF 236
297840475 242 LKYETMRADPLPHVKRLAQFMGYGFTAEEEKKGVVEKVVNLCSFETLKNLEVNEGEKIREDIASVhWPNSAYFRKGMVGD 321
15221130  241 LKYETMRADPLPYVKSLAEFMGHGFTAEEEEKGVVEKVVNLCSFETLKNLEANKGEKDREDRPGV-YANSAYFRKGKVGD 319
15221131  229 LRYETMRANPLPFVKRLAEFMGYGFTDEEEENGVAEKVVKLCSFETLKNLEANKGDKEREDRPAV-YANSAYFRKGKVGD 307
15221820  237 LKYETMRADPLPYVKRLAEFMGYGFTKEEEEGNVVEKVVKLCSFETLKNLEANKGEKDREDRPAV-YANSAYFRKGKVGD 315
297844812 237 LKYETMRADPLPYVKRLAEFMGYGFTKEEEEEKVVEKVVKLCSFETLKNLEANKGEKDREDRPAV-YANSAYFRKGKVGD 315
297842165 229 LRYETMRANPLPFVKRLAEFMGYGFTDEEEEKGVAEKVVKLCSFETLKNLEANKGDKEREDRPAV-YANSAYFRKGKVGD 307
297839289 237 LKYETMRADPLPYVKSLAEFMGYGFTAEEEKKGVVEKVVNLCSFETLKNLEANKGEKDREDRPGV-YANSAYFRKGKVGD 315
297840475 322 WHNYLTPEMAARIDGLMHEKFKGSGLLEHDI 352
15221130  320 WSNYLTPEMAARIDGLMEEKFKGTGLLEHGK 350
15221131  308 WANYLTPEMAARIDGLVEEKFKDTGLLQHDN 338
15221820  316 WQNYLTPEMVARIDGLMEEKFKGTGFLSSKS 346
297844812 316 WQNYLTPEMVARIDGLMEEKFKGTGFLTSTT 346
297842165 308 WANYLTPEMAARIDGLVEEKFKDTGLLQHDS 338
297839289 316 WSNYLTPEMAARIDGLMEDKFKGTGLLEHGK 346
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap