Conserved Protein Domain Family
PLN02162

?
PLN02162: PLN02162 
triacylglycerol lipase
Statistics
?
PSSM-Id: 177821
View PSSM: PLN02162
Aligned: 2 rows
Threshold Bit Score: 926.372
Threshold Setting Gi: 79588733
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297846876   1 MKFCNSYFLVDPTKASFLDLLLLLFSFNLTSARFIDSPPDTLKSFRRSFASRWILALAILLQKVLMLLSKPFAFLGRLLT 80 
79588733    6 MKFCNSYFLVDPTKASFLDLLLLLFSSNLTSARFIDSPPDTLKGFRRSFASRWILALAIFLQKVLMLLSKPFAFIGQKLT 85 
297846876  81 YWLNLLTANGGFFNLILNLLTGKLVKPDKSSATYTSFIGCSDRRIELDEKIDVGSIEYKSMLSIMASKISYESKPFVNSV 160
79588733   86 YWLNLLTANGGFFNLILNLMSGKLVKPDKSSATYTSFIGCSDRRIELDEKINVGSIEYKSMLSIMASKISYESKPYITSV 165
297846876 161 VKNTWKMDLVGNYDFYNAFQESKLTQAFVFKTSSTNPDLIVVSFRGTEPFEAADWCTDLDLSWYELKNVGKVHAGFSRAL 240
79588733  166 VKNTWKMDLVGNYDFYNAFQESKLTQAFVFKTSSTNPDLIVVSFRGTEPFEAADWCTDLDLSWYEMKNVGKVHAGFSRAL 245
297846876 241 GLQKDgGWPKENISLLHQYAYYTIRQMLRDKLARNKNLKYILTGHSLGGALAALFPAILAIHGEDELLDKLEGIYTFGQP 320
79588733  246 GLQKD-GWPKENISLLHQYAYYTIRQMLRDKLGRNKNLKYILTGHSLGGALAALFPAILAIHGEDELLDKLEGIYTFGQP 324
297846876 321 RVGDEDFGEFMNGVVKKHGIEYERFVYNNDVVPRVPFDDKLLFSYKHYGPCNSFNSLYKGKVREDAPNANYFNLLWLIPQ 400
79588733  325 RVGDEDFGEFMKGVVKKHGIEYERFVYNNDVVPRVPFDDKYLFSYKHYGPCNSFNSLYKGKVREDAPNANYFNLLWLIPQ 404
297846876 401 LLTGLWEFIRSFILQFWKGEEYKENWLMRFVRVVGIVFPGGSNHFPFDYVNSTRLGGLVRPPPSTTPEDKLALIA 475
79588733  405 LLTGLWEFIRSFILQFWKGDEYKENWLMRFVRVVGIVFPGGSNHFPFDYVNSTRLGGLVRPPPTTTPEDKLALIA 479
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap