Conserved Protein Domain Family
PLN02161

?
PLN02161: PLN02161 
beta-amylase
Statistics
?
PSSM-Id: 177820
View PSSM: PLN02161
Aligned: 3 rows
Threshold Bit Score: 1145.93
Threshold Setting Gi: 225461918
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
79537398    1 MTETGVIGCGC--RGVTGgnfFHPGGFSLKScfleqstkRNRNFFRSVSMIPPFKRGRFITkLRSVAGNSRIFSMDAREK 78 
225461918   1 MAENGGVACKCteRGIYG---FRGARFDKRS--------RIRKNLRNVSMIPLFKHNGLFI-WRSIAANNCIFSMDAREK 68 
297793045   1 MAETGVIGCGC--RGVTGgnfFHPGGFSLKScfleqstkRNRNFFRSVSMIPPSKRGRFITkWRSVAGNSRIFSMDAREK 78 
79537398   79 SRSFVLVSSRHKRVPVFVMMPIDTFGIDASGCPKIKRLKALTVSLKALKLAGVHGIAVEVWWGIVERFSPLEFKWSLYEE 158
225461918  69 SRSTTLETPGHKRVPIFVMMPVDSFGIDTSGAPRIRRIKALTISLKALKLAGVHGIAVEVWWGIVERFSPFVYNWSLYEE 148
297793045  79 SRSFVLVSSRHKRVPVFVMMPFDTFGIDASGCPKIKRLKALTVSLKALKLAGVHGIAVEVWWGIVERFCPLEFKWSLYEE 158
79537398  159 LFRLISEAGLKLHVALCFHSNMHLFGG-KGGISLPLWIREIGDVNKDIYYRDKSGFSNNDYLTLGVDQLPLFGGRTAVQC 237
225461918 149 LFKLISESGLKLHVALSFHSNMHSSSRvKGGVSLPLWIVEIGDLNKDIYYRDQNGFSNDDYLTLGVDELPLFCGRTALQC 228
297793045 159 LFRLISEAGLKLHVALCFHSNMHLFGG-KGGISLPLWIREIGDVNKDIYYRDKRGLSNNDYLTLGVDQLPLFGGRTAVQC 237
79537398  238 YEDFMLSFSTKFEPYLGNVIEEISIGLGPSGELRYPAHPSGDGRWKFPGIGEFQCHDKYMMEDLMAVASQEGKPQWGSRD 317
225461918 229 YEDFMFSFINKFESFIGSVIEEISVGLGPSGELRYPAHPFGDGRWRFPGIGEFQCYDKYMMRDLKIAACQEGKPQWGDKG 308
297793045 238 YEDFMLSFSTKFEPYFGNVIEEISIGLGPSGELRYPAHPSGDGRWKFPGIGEFQCHDKYMMEDLMAVASQEGKPQWGSRD 317
79537398  318 PPNTGCYNSFPSGVPFFEEGNDSFLSDYGRFFLEWYSGKLICHADAILAKAADVLRRRQEEEKSSVMLVAKIGGIYWWYK 397
225461918 309 PQNAGYYNSLPSGVPFFEEGQESFLSDYGRFFLEWYSGRLIRHADAILTKAANMLKKYQESKKSSVLLVAKIGGIYWWYH 388
297793045 318 PPNTGCYNSFPSGVPFFEEGNDSFLSDYGRFFLEWYSGKLICHADAILAKAADVLRRRQEDEKSSVMLVAKIGGIYWWYK 397
79537398  398 TSSHPAELTAGYYNTSLRDGYDPVASVLSRHGAALNIPCLDMADSEIPEKYLCSPEGLRRQIHDVSKKWTIHVTGRNTSE 477
225461918 389 TLSHPAELTAGYYNTALRDGYDPVASMLSRHGAALHISCLEMMDNETPPTYLCSPERLLQQIWTVSKKRIVHLTGRNTNE 468
297793045 398 TSSHPAELTAGYYNTALRDGYDPVASVLSRHGAALHIPCLDMADSETPEKYLCSPEGLRKQIHDVSKKWTIQVTGRNTSE 477
79537398  478 RFDEMGLRQIRENCVQPNGDTLRSFTFCRMNEKIFRVENWNNFVPFIRQMSADM 531
225461918 469 RFDKAGLWQIHANCYHPQAEAVRSFTYFRMNEKIFRAENWNNFVPFVRKMSTDM 522
297793045 478 RFDEMGLRQIRENCVQPNGDTLRSFTFCRMNEKIFRGENWNNFVPFIRQMSADM 531
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap