Conserved Protein Domain Family
PLN02160

?
PLN02160: PLN02160 
thiosulfate sulfurtransferase
Statistics
?
PSSM-Id: 177819
View PSSM: PLN02160
Aligned: 3 rows
Threshold Bit Score: 286.211
Threshold Setting Gi: 297797771
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
79332639    1 MSQSISSSTKAEEVVSVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYMLNTPQGRVKNQEFLEQVSSLLNP 80 
145359718   1 MSQSISSSTKAEEVVSVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYMLNTPQGRVKNQEFLEQVSSLLNP 80 
297797771   1 MSQSISSSTKAEEVVSVDVSEAKTLLQSGHQYLDVRTQEEFRRGHCEAAKIVNIPYMINTPQGRVKNQDFLEQVSSLLDP 80 
79332639   81 ADDILVGCQSGARSLKATTELVAAvsGYKKVRNVGGGYLAWVDHSFPINTEEEEPSAN 138
145359718  81 ADDILVGCQSGARSLKATTELVAA--VRLQESEKRGRWLLGLGGSQLSHQHGGGGAIC 136
297797771  81 ADDILVGCQSGARSLKATTELVAA--GYKKVRNMGGGYLAWVDHSFPINEEEEEPSAN 136
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap