Conserved Protein Domain Family
PLN02159

?
PLN02159: PLN02159 
Fe(2+) transport protein
Statistics
?
PSSM-Id: 177818
View PSSM: PLN02159
Aligned: 5 rows
Threshold Bit Score: 597.306
Threshold Setting Gi: 79478110
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
79325171    1 MATTKLVYILLILFTFTVSPAISTAPEHCDSGFDNPCINKAKALPLKIVAIVAILTTSLIGVTSPLFSRYISFLRPDGNG 80 
79478110    6 ALLMKTIFLVLIFVSFAISPATSTAPEECGSESANPCVNKAKALPLKVIAIFVILIASMIGVGAPLFSRNVSFLQPDGNI 85 
297804168   6 ALLMKTIFLVLIFVSFAISPATSTAPEECGSESANPCVNKAKALPLKIIAIVAILIASMIGVGAPLFSRNVPFLQPDGNI 85 
297804172   1 MATTKLVYILLILFTFSVSPAIATAPEHCDSGSENPCINKAKALPLKIVAIVAILTTSLIGVTSPLFSRYISFLRPDGNG 80 
297791283   6 TTLMKLFFFALILVSFIVSPATSTAPEECEAESTNPCLNKTKALPLKIISIVAILLTSMIGVSAPLFSRYVPILHPDGNI 85 
79325171   81 FMIVKCFSSGIILGTGFMHVLPDSFEMLSSKCLSDNPWHKFPFAGFVAMMSGLVTLAIDSITTSLYTGKNSVGPVPdeey 160
79478110   86 FTIIKCFASGIILGTGFMHVLPDSFEMLSSICLEENPWHKFPFSGFLAMLSGLITLAIDSMATSLYTSKNAVGIMP---- 161
297804168  86 FTIIKCFASGIILGTGFMHVLPDSFEMLSSICLEENPWHKFPFSGFLAMLSGLITLAIDSMATSLYTSKNAVGIMP---- 161
297804172  81 FMIVKCFSSGIILGTGFMHVLPDSFEMLSSKCLSDGPWHKFPFAGFVAMMSGLVTLAIDSITTSLYTGKNSVGPVPdeys 160
297791283  86 FTIVKAFASGIILGTSFMHVLPDSFEMLSSECLEDDPWHKFPFTGFVAMLSGLVTLAIDSMATSFYSSKNGTNPMIt--- 162
79325171  161 gidqekaihmvgHNHSHGHG------VVLATKDDG--QLLRYQVIAMVLEVGILFHSVVIGLSLGATNDSCTIKGLIIAL 232
79478110  162 ------------HGHGHGHGpandvtLPIKEDDSSnaQLLRYRVIAMVLELGIIVHSVVIGLSLGATSDTCTIKGLIAAL 229
297804168 162 --------------HGHGHGpannvtLPIKEDDSAnaQLLRYRVIAMVLELGIIVHSVVIGLSLGATSDTCTIKGLIAAL 227
297804172 161 idqe-kaihivgHNHSHGHG------VVLSTKDDG--QLLRHRVIAMVLELGILFHSVVIGLSLGATNDACTIKGLIIAL 231
297791283 163 ------------HGHSHGHG------VTLNTKDDGssHLLRYRVIAMVLELGIIVHSVVIGLSLGATNDTCTIKGLIAAL 224
79325171  233 CFHHLFEGIGLGGCILQADFTNVKKFLMAFFFTGTTPCGIFLGIALSSIYRDNSPTALITIGLLNACSAGMLIYMALVDL 312
79478110  230 CFHQMFEGMGLGGCILQAEYTNMKKFVMAFFFAVTTPFGIALGIALSTVYQDNSPKALITVGLLNACSAGLLIYMALVDL 309
297804168 228 CFHQMFEGMGLGGCILQAEYTNMKKFVMAFFFAVTTPFGIALGIALSTVYQDNSPKALITVGLLNACSAGLLIYMALVDL 307
297804172 232 CFHHLFEGMGLGGCILQADFTNVKKFLMAFFFAGTTPCGIFLGIVLSSIYRDNSPTALITIGLLNACSAGMLIYMALVDL 311
297791283 225 CFHQMFEGMGLGGCILQAEYTTVKKFMMAFFFAVTTPFGIVLGIALSSIYRDNSPTALITVGLLNACSAGLLIYMALVDL 304
79325171  313 LATEFMGSMLQGSIKLQIKCFTAALLGCAVMSVVAVWA 350
79478110  310 LAAEFMGPKLQGSIKMQFKCLIAALLGCGGMSIIAKWA 347
297804168 308 LAAEFMGPKLQGSIKMQFKCLVAALLGCGGMSIIAKWA 345
297804172 312 LATEFMGSMLQGSIKLQIKCFMAALLGCAVMSVVAVWA 349
297791283 305 LAAEFMGPKLQGNIKLQIKCFFAALLGCGGMSILAKWA 342
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap