Conserved Protein Domain Family
PLN02157

?
PLN02157: PLN02157 
3-hydroxyisobutyryl-CoA hydrolase-like protein
Statistics
?
PSSM-Id: 177817
View PSSM: PLN02157
Aligned: 2 rows
Threshold Bit Score: 813.148
Threshold Setting Gi: 297820912
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
42566089    1 MHNAKGLLGRIVRDKLWRFGYRRSLCSLKLTSEDLDYQVLVEGSGCSRTAILNRPPALNALTTHMGYRLQKLYKNWEEDP 80 
297820912   1 MHNANGLLGRIVRDKLWRFGYRRSFCSLKVTPEDLDYQVLVEGSGCSRTAILNRPPALNALTTHMGYRLQKLYKNWEEDP 80 
42566089   81 NIGFVMMKGSGRAFCAGGDIVSLYHLRTRGSPDAIREFFSSLYSFIYLLGTYLKPHVAILNGVTMGGGTGVSIPGTFRVA 160
297820912  81 NIGFVMMKGSGRAFCAGGDIVSLYHLRKRGSPDAIREFFSSLYSFIYLLGTYLKPHVAILNGVTMGGGTGVSIPGTFRVA 160
42566089  161 TDRTIFATPETIIGFHPDAGASFNLSHLPGRLGEYLGLTGLKLSGAEMLACGLATHYIRSEEVPVMEEQLKKLLTDDPSV 240
297820912 161 TDRTIFATPETIIGFHPDAGASFNLSHLPGRLGEYLGLTGLKLSGAEMLACGLATHYIRSEEIPVMEEQLKKLLTDDPSV 240
42566089  241 VESCLEKCAEVAHPEKTGVIRRIDLLEKCFSHDTVEEIIDSLEIEASRRKDTWCITTLRRLKESSPLSLKVALRSIREGR 320
297820912 241 VESSLEKCAEVAHPEKTGVIRRIDLLEKCFSHDTVEEIIDSLEIEAGRRKDTWCITTLRRLKESSPLSLKVALRSIREGR 320
42566089  321 LQTLDQCLIREYRMSLQGLIGPMSGNFCEGVRARLIDKDEAPKWDPPSLEKVSEDMVDDYFCALTPTEPDLDLPVKLRES 400
297820912 321 LQTLDQCLIREYRMSLQGLIGPMSGNFCEGVRARLIDKDEAPKWDPPSLEKVSEDMVDNYFSALTPTEPDLELPVKLRES 400
42566089  401 I 401
297820912 401 I 401
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap