Conserved Protein Domain Family
PLN02156

?
PLN02156: PLN02156 
gibberellin 2-beta-dioxygenase
Statistics
?
PSSM-Id: 177816
View PSSM: PLN02156
Aligned: 4 rows
Threshold Bit Score: 685.962
Threshold Setting Gi: 297845928
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15220645    1 MVVLPQPVTLDNHISLIPTYKPVPVLtshsIPVVNLADPEAKTRIVKACEEFGFFKVVNHGVRPELMTRLEQEAIGFFGL 80 
15226777    1 MVIVLQPASFDSNLYVNPKCKPRPVL----IPVIDLTDSDAKTQIVKACEEFGFFKVINHGVRPDLLTQLEQEAINFFAL 76 
297845928   1 MVVLPQPVTLENHISLIPTYKPVPVLtshsIPVVNLTDPEAKTRIVKACEEFGFFKVVNHGVRPELMTRLEQEAIGFFAL 80 
297823239   1 MVIVLQPATFDSNLYVNPKCKPSPVL----IPVIDLTDSDAKTQIVKACEEFGFFKVINHEVRPDLLSQLEQEAIKFFAS 76 
15220645   81 PQSLKNRAGPPEPYGYGNKRIGPNGDVGWIEYLLLNANPQLSSPKTSAVFRQTPQIFRESVEEYMKEIKEVSYKVLEMVA 160
15226777   77 HHSLKDKAGPPDPFGYGTKRIGPNGDLGWLEYILLNANLCLESHKTTAIFRHTPAIFREAVEEYIKEMKRMSSKFLEMVE 156
297845928  81 PQSLKNRAGPPEPYGYGNKRIGPNGDVGWIEYILLNANPQLSSPKTSAVFRQTPQIFRESVEEYMKEIKEVSYKVLEMVA 160
297823239  77 PHSLKDKASPPDPFGYGTKRIGPNGDVGWLEYILLNANLCLESHKTTAVFRHTPAIFREAVEEYMKEMKRMSSKVLEMVE 156
15220645  161 EELGIEPRDTLSKMLRDEKSDSCLRLNHYPAAEEEAEKmVKVGFGEHTDPQIISVLRSNNTAGLQICVKDGSWVAVPPDH 240
15226777  157 EELKIEPKEKLSRLVKVKESDSCLRMNHYPEKEETPVK-EEIGFGEHTDPQLISLLRSNDTEGLQICVKDGTWVDVTPDH 235
297845928 161 EELGIEPRDTLSKMLRDEKSDSCLRLNHYPAAEEEAEKmVKVGFGEHTDPQIISVLRSNNTAGLQICVKDGSWVAVPPDH 240
297823239 157 EELKIEPKEKLSHLVKVKESDSCLRMNHYPEKEETPAK-GEIGFGEHTDPQLISLLRSNDTKGFQICVKDGTWVDVSPDH 235
15220645  241 SSFFINVGDALQVMTNGRFKSVKHRVLADTRRSRISMIYFGGPPLSQKIAPLPCLVPEQDDWLYKEFTWSQYKSSAYKSK 320
15226777  236 SSFFVLVGDTLQVMTNGRFKSVKHRVVTNTKRSRISMIYFAGPPLSEKIAPLSCLVPKQDDCLYNEFTWSQYKLSAYKTK 315
297845928 241 SSFFINVGDALQVMTNGRFKSVKHRVLADTRRSRISMIYFGGPPLSEKIAPLPCLVPEQDDWLYKEFTWSQYKSSAYKSK 320
297823239 236 SSFFVLVGDTLQVMTNGRFKSVKHRVVTNTKRSRISMIYFAGPPLSEKIAPLSCLVPKQDDCLYNEFTWSQYKLSAYKTK 315
15220645  321 LGDYRLGLFEKQPLLNHKTL 340
15226777  316 LGDYRLGLFEKRPPFSLSNV 335
297845928 321 LGDYRLGLFEKQPLLTHKTI 340
297823239 316 LGGYRLGLFERPPPFSLSSV 335
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap