Conserved Protein Domain Family
PLN02155

?
PLN02155: PLN02155 
polygalacturonase
Statistics
?
PSSM-Id: 165802
View PSSM: PLN02155
Aligned: 4 rows
Threshold Bit Score: 685.261
Threshold Setting Gi: 297848848
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15220596    1 MTKSAITFPLIFTLLTFIDVSSSASIVFNVVSFGAKPDGVTDSTAAFLKAWQGACGSAASATVVVPTGTFLLKVITFGGP 80 
15220597    1 MTKSVIRFSLLFTLLTFIDVSISASNVFNVVSFGAKPDGVTDSTGAFLKAWQGACVSASSATVVVPKGTFLLKVITFGGP 80 
297848848   1 MTKPAITFPLIFTLLTFIDVSSSASIVFNVVSFGAKPDGVTDSTAAFLKAWQGACGSVSSATVVVPTGTFLLKVITFGGP 80 
297848850   1 MTKPAITFPLLFTLLTFIDVSSTASNVFNVVSFGAKPDGVTDSTAAFLKAWQRACGSASSATVVVPNGTFLLKVITFGGP 80 
15220596   81 CKSKITFQVTGTVVAPEDYRTFGNSGSWILFNKVNRFSLVGGTFDARGSGFWSCRKSGQNCPPGVRSISFNSAKDVIISG 160
15220597   81 CKSKITFQVAGTVIAPEDYRTFGNSGFWILFNKVNRFSLVGGTFDARANGFWSCRKSGQNCPPGVRSISFNSAKDVIISG 160
297848848  81 CKSKITFQVAGTIVAPEDYRTFGNSGYWILFNKVNRFSLVGGTFDARANGFWSCRKSGQNCPPGVRSISFNSAKDVIISG 160
297848850  81 CKSKITFQVTGTVVAPEDYRTFGNSGYWILFNKVNRFSLVGGTFDARANGFWSCRKSGQNCPPGVRSISFNSAKDVIISG 160
15220596  161 VKSMNSQVSHMTLNGCTNVAVRNIRLVAPGDSPNTDGFTVQFSTGVTLTGSTVQTGDDCVAIGQGTRNFLISKLACGPGH 240
15220597  161 VKSMNSQVTHMTLNGCTNVVVRNVKLVAPGNSPNTDGFHVQHSTGVTFTGSTVQTGDDCVAIGPGTRNLLITKLACGPGH 240
297848848 161 VKSMNSQVSHMTLNGCTNVVVRNVRLVAPGDSPNTDGFTVQFSTGVTFTGSTVQTGDDCVAIGQGTRNFLISKLACGPGH 240
297848850 161 VKSMNSQVSHMTLNGCTNVVVRNVKLVAPGNSPNTDGFHVQLSTGVTFTGSTVQTGDDCVAIGPGTRNFLITKLACGPGH 240
15220596  241 GVSIGSLAKQLNEDGVENVTVSSSVFTGSQNGVRIKSWARPSTGFVRNVFFQNLIMRNVQNPIIIDQNYCPSNQGCPTEH 320
15220597  241 GVSIGSLAKELKEDGVENVTVSSSVFTGSQNGVRIKSWARPSNGFVRTVFFQDLVMKNVENPIIIDQNYCPTHEGCPNEY 320
297848848 241 GVSIGSLAKQLNEDGVENVTVSSSVFTGTQNGVRIKSWARPSTGFVRNVFFQNLIMKNVQNPIIIDQNYCPSKQGCPTEH 320
297848850 241 GVSIGSLAKELNEDGVENVTVSSSVFTGSQNGVRIKSWARPSTGFVRNVFFQDLVMKNVENPIIIDQNYCPTHEGCPNEY 320
15220596  321 SGVKITQVTYKNIQGTSATQEAMKLVCSKSNPCTGITLQDIKLTYNKGTPATSLCFNAVGKNLGVIQPTSCLNR 394
15220597  321 SGVKISQVTYKNIQGTSATQEAMKLVCSKSSPCTGITLQDIKLTYNKGTPATSFCFNAVGKSLGVIQPTSCLNR 394
297848848 321 SGVKISQVTYKNIQGTSATQQAMNLACSKSNPCTGITLQDIKLIYNKGTPATSFCFNAVGKNLGVIQPTSCLNR 394
297848850 321 SGVKISQVTYKNIQGTSATQEAMKLVCSKSSPCTGITLQDIKLIYNKGTPATSLCFNAVGKSLGVIQPTSCLNR 394
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap