Conserved Protein Domain Family
PLN02153

?
PLN02153: PLN02153 
epithiospecifier protein
Statistics
?
PSSM-Id: 177814
View PSSM: PLN02153
Aligned: 3 rows
Threshold Bit Score: 699.431
Threshold Setting Gi: 297853188
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297853188   1 MAATFQGGWIKVEQRGGKGPGPRCSHGMAVIGDKLYCLGGELKPNEAIDKDLYVFYFNTHTWSIAPANGDVPRISTFGVR 80 
30695636    1 MAPTLQGQWIKVGQKGGTGPGPRSSHGIAAVGDKLYSFGGELTPNKHIDKDLYVFDFNTQTWSIAQPKGDAPTVSCLGVR 80 
297832568   1 MAPTLQGEWIKMEQKGGKGPGPRCSHGIAMVGDKLYSFGGELIPNMHIDKDLYVFDFNTHTWSIAPANGDPPRISCLGVR 80 
297853188  81 MVAVGNKLYVFGGRNEKREFSDFYSYDTVKNEWKFLTKLDVEGGPEARTFHSMASDENYVYVFGGVSKgGGLMKTPERFR 160
30695636   81 MVAVGTKIYIFGGRDENRNFENFRSYDTVTSEWTFLTKLDEVGGPEARTFHSMASDENHVYVFGGVSK-GGTMNTPTRFR 159
297832568  81 MVAVGTKLYIFGGRDAKRAFNDFYSYDTVQKEWTFLTKLDEEGGPEARTFHSMTSDENHVYVFGGVSK-GGLQTTPKRFR 159
297853188 161 TIEAYNVADGKWVQLPDPGENFEKRGGAGFLVAQGKIWVVYGFATSSLPGGKSDYESNAVQFFDPALGKWTEVETTGAKP 240
30695636  160 TIEAYNIADGKWAQLPDPGDNFEKRGGAGFAVVQGKIWVVYGFATSIVPGGKDDYESNAVQFYDPASKKWTEVETTGAKP 239
297832568 160 TIEAYNIADGGWVQLPDPGENFEKRGGAGFAVVQGKIWVVYGFATSIIPGGKNDYESNAIQYFDPASGKWTQVKTTGAKP 239
297853188 241 SARSVFAHAAVGKYIIIFGGEIWPDPKAHLGPGTLSNEGYALNTETLVWEKFGGCDEPEMPRGWTAYTTATLYGKNGLLM 320
30695636  240 SARSVFAHAVVGKYIIIFAGEVWPDLNGHYGPGTLSNEGYALDTETLVWEKLGEEGAPAIPRGWTAYTAATVDGKNGLLM 319
297832568 240 SARSVFAHAVVGKYIIIFGGEVWPDLKGHLAPGTLSNEGYVLDTETLVWDKLAEGGEPAMPLGWTSYTTATVYGKKGLLM 319
297853188 321 HGGKLPTNGRADDLYFYAVNSA 342
30695636  320 HGGKLPTNERTDDLYFYAVNSA 341
297832568 320 H-GKLPTNERTGDLYFYAVNSA 340
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap