Conserved Protein Domain Family
PLN02152

?
PLN02152: PLN02152 
indole-3-acetate beta-glucosyltransferase
Statistics
?
PSSM-Id: 177813
View PSSM: PLN02152
Aligned: 4 rows
Threshold Bit Score: 962.205
Threshold Setting Gi: 297848828
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15220556    1 MAQPHFLLVTFPAQGHVNPSLRFARRLIKTTGARVTFATCLSVIHRSMIPNHNNVEN-LSFLTFSDGFDDGVISNTDDVQ 79 
18390540    1 MAPPHFLLVTFPAQGHVNPSLRFARRLIKRTGARVTFVTCVSVFHNSMIANHNKVEN-LSFLTFSDGFDDGGISTYEDRQ 79 
297848828   1 MALPHFLLVTFPAQGHVNPSLRFARRLIKTTGTRVTFATCLSAINRSMIPDHNNVNDlLSFLTFSDGFDDGVISNTDDVQ 80 
297848834   1 MAPPHFLLVTFPAQGHVNPSLRFARRLIKTTGTRVTFVACVSVFHNSMIPNHNNVDN-LSFLTFSDGFDDGGISTYEDRQ 79 
15220556   80 NRLVHFERNGDKALSDFIEANQNGDSPVSCLIYTILPNWVPKVARRFHLPSVHLWIQPAFAFDIYYNYSTGNNSVFEFPN 159
18390540   80 KRSVNLKVNGDKALSDFIEATKNGDSPVTCLIYTILLNWAPKVARRFQLPSALLWIQPALVFNIYYTHFMGNKSVFELPN 159
297848828  81 NRLLNFERNGDKALSDFIEANLNGDSPVTCLIYTILPNWAPKVARRFHIPSVLLWIQPAFVFDIYYNYSTGNNSVFEFPN 160
297848834  80 KRTANLKVNGDKALSEFIEASRNGDSPVTCVIYTILLNWAPKVARRFQLPSALLWIQPALVFDIYYNHFMGNNSVFKLTN 159
15220556  160 LPSLEIRDLPSFLSPSNTNKAAQAVYQELMDFLKEESNPKILVNTFDSLEPEFLTAIPNIEMVAVGPLLPAEIFTGSESG 239
18390540  160 LSSLEIRDLPSFLTPSNTNKGAYDAFQEMMEFLIKETKPKILINTFDSLEPEALTAFPNIDMVAVGPLLPTEIFSGSTNK 239
297848828 161 LPSLAIRDLPSFLSPSNTNKAAQAVYLELMEFLKEESNPKILVNTFDSLEPDFLTAIPNVEMVAVGPLLPAEIFTGSESG 240
297848834 160 LSSLEIRDLPSFLTPSNTNKAAYDSFQEMMEFLIEETNPKILINTFDSLEPEALTAFPNIDMVAVGPLLPTEIFSGSAK- 238
15220556  240 kdlSRDHQSSSYTLWLDSKTESSVIYVSFGTMVELSKKQIEELARALIEGGRPFLWVITDKLNREAKIEGEEETEIEKIA 319
18390540  240 ---SVKDQSSSYTLWLDSKTESSVIYVSFGTMVELSKKQIEELARALIEGKRPFLWVITDKSNRETKTEGEEETEIEKIA 316
297848828 241 kdlS-RDQSSSYKLWLDSKTESSVIYVSFGTMVELSKKQIEELARALIEGKRPFLWVITNKLNREAKIEGEEETEIEKIA 319
297848834 239 ---SVEDQSSSYTLWLDSKTESSVIYVSFGTMVELSKKQIEELARALIEGKRPFLWVITDKSNRETKTEGEEETEIEKIA 315
15220556  320 GFRHELEEVGMIVSWCSQIEVLRHRAIGCFLTHCGWSSSLESLVLGVPVVAFPMWSDQPANAKLLEEIWKTGVRVRENSE 399
18390540  317 GFRHELEEVGMIVSWCSQIEVLSHRAVGCFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWKTGVRVRENKD 396
297848828 320 SFRHELEEVGMIVSWCSQIEVLRHRAVSCFVTHCGWSSSLESLVLGVPVVAFPMWSDQPANAKLLEKIWKTGVRVRENSE 399
297848834 316 GFRHELEEVGMMVSWCSQIDVLSHRAVGCFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWKTGVRVRENEE 395
15220556  400 GLVERGEIMRCLEAVMEAKSVELRENAEKWKRLATEAGREGGSSDKNVEAFVKSLF 455
18390540  397 GLVERGEIRRCLEAVMEEKSVELRENAKKWKRLAMEAGREGGSSDKNMEAFVEDIC 452
297848828 400 GLVERGEIKRCLEAVMEEKSEELRESAEKWKRLAIEAGGEGGSSDKNVEAFVKTLC 455
297848834 396 GLVERGEIRRCLEAVMEDKSVELRESAKKWKRLAIEAGGEGGSLDKNMEAFVEEIC 451
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap