Conserved Protein Domain Family
PLN02151

?
PLN02151: PLN02151 
trehalose-phosphatase
Statistics
?
PSSM-Id: 177812
View PSSM: PLN02151
Aligned: 4 rows
Threshold Bit Score: 745.727
Threshold Setting Gi: 297802086
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297825103   1 MVRFVEENTTKMLETKVISNSEVLYVGRDDGDTSPSTKALHDFQINggGGGGLIRSWVDSMRACSPTRPKSFNNQSCWIK 80 
79560035    1 MVRFIEENITKMLETKAISNSEVLYVGGDDGDTSPTTKVLHDFQIN--SGGGLIRSWVDSMRACSPTRPKSFNSQSCWIK 78 
30692524    1 MVRFIEEN-TKLVEKETGNKS-------NNDVTTTKKKALQDIIIN--NGVGLINSWVDSMRACSPTHLKSLLKQSSWLT 70 
297802086   1 MVRFIEEN-TKLVEKETGNKS-------NNDVTTTKKKVLQDLSIN--NGGGLINSWVDSMRACSPTHLKSLLKQSSWLT 70 
297825103  81 EHPSALNMFEEILNKSEGKQVVMFLDYDGTLSPIVDDPDRAFMSKKMRNTVRKLAKCFPTAIVSGRCREKVSSFVKLTEL 160
79560035   79 EHPSALNMFEEILHKSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRNTVRKLAKCFPTAIVSGRCREKVSSFVKLTEL 158
30692524   71 EHPSALDMFEEILHLSEGKQIVMFLDYDGTLSPIVDDPDRAFMSRKMRRTVRKLANCFPTAIVSGRCIEKVYNFVKLTEL 150
297802086  71 EHPSALDMFEEILHLSEGKQIVMFLDYDGTLSPIVDDPDRAFMSKKMRRTVRKLANCFPTAIVSGRCREKVYNFVKLTEL 150
297825103 161 YYAGSHGMDIKGPEQGPKYKK---ENQSLLCQPATEFLPVINEVFKKLLEKTKSIPGAKVENNKFCASVHFRCVEENKWS 237
79560035  159 YYAGSHGMDIKGPEQGSKYKK---ENQSLLCQPATEFLPVINEVYKKLVENTQSIPGAKVENNKFCASVHFRCVEENKWS 235
30692524  151 YYAGSHGMDIKGPEQGSKYEQilqDSKSLLCQPATEFLPMIDEVYHKLVEKTKSTPGAQVENNKFCVSVHFRRVDENNWS 230
297802086 151 YYAGSHGMDIKGPEQGSKFEEvrfDSKSLLCQPATEFLPMIDEVYKKLVEKTKFTPGAQVENNKFCVSVHFRRVDENNWS 230
297825103 238 DLANQVRSVLKNYPKLMLTQGRKVLEIRPIIKWDKGKALEFLLESLGYNNCTDVFPIYIGDDLTDEDAFKILRDKKQGLG 317
79560035  236 DLAHQVRSVLKNYPKLMLTQGRKVLEIRPIIKWDKGKALEFLLESLGYDNCTDVFPIYIGDDRTDEDAFKILRDKKQGLG 315
30692524  231 DLANQVRSVMKDYPKLRLTQGRKVLEVRPIIKWDKGKALEFLLESLGYANCTDVFPLYIGDDRTDEDAFKVLRERRQGLG 310
297802086 231 DLANQVRSVMKDYPKLRLTQGRKVLEVRPIIKWDKGKALEFLLESLGYANCTDVFPLYIGDDRTDEDAFKILRERRQGLG 310
297825103 318 ILVSKYAKETNASYSLQEPDEVMDFLERLVDWKQLRCGA 356
79560035  316 ILVSKYAKETNASYSLQEPDEVMVFLERLVEWKQSRCGA 354
30692524  311 ILVSKFPKETSASYSLQEPDEVMEFLQRLVEWKQLRSGA 349
297802086 311 ILVSKFPKETSASYSLQEPDEVMEFLQRLVEWKQLRSGA 349
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap