Conserved Protein Domain Family
PLN02150

?
PLN02150: PLN02150 
terpene synthase/cyclase family protein
Statistics
?
PSSM-Id: 177811
View PSSM: PLN02150
Aligned: 3 rows
Threshold Bit Score: 174.271
Threshold Setting Gi: 297846354
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30690126    1 MRKGEVVNGVNSYMNQHGVTKEEAVEELRKMARDNYKIVMEELLTITDVPRPVLVRCLNLARLFDVFCKNSNDEFTYPHG 80 
297846354   1 MRRGEVANGVKCYIKKQRVTKEVAVSQMKKMIRDNYKIVMEEFLTIKGVPRPILVRVLNILRMINVYNYEEGDGFTKPHE 80 
297851798  34 MRRGEVANGVNCYMKQHGVTKELAVSEIKKMIRDNHKTVMEEFLTTKCVPHPVLVRCLNMVRLIKLY-YTEGDGYTNPRR 112
30690126   81 NLKDLITSIFIHPIPV 96 
297846354  81 KLKDLITALFFYPLPL 96 
297851798 113 KIKDLITSLFFHPLPL 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap