Conserved Protein Domain Family
PLN00417

?
PLN00417: PLN00417 
oxidoreductase, 2OG-Fe(II) oxygenase family protein
Statistics
?
PSSM-Id: 177810
View PSSM: PLN00417
Aligned: 7 rows
Threshold Bit Score: 670.126
Threshold Setting Gi: 297796255
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15239524    1 MEKPKLKTVQEVVAAGEKLPERYLYTPTGDGEGdQPFNGLLPEMKISIIDLNLLFSSSDDGREELSKLHSAISTWGVVQV 80 
15222131    1 MEKPKFKTVQEVVAAGQGLPERYLHAPTGEGES-QPLNGAVPEMDIPAIDLSLLFSSSVDGQEEMKKLHSALSTWGVVQV 79 
15241383    1 MEKPKFKTVQEVVAAGEGIPERYLQPPAVDDNG-QHLNAAVPVMDIPAIDLSLLLSPSDDGREELSKLHSALSTWGVVQV 79 
15241348    1 MEKPKFKTVQEVVAAGEGLPERYLHAPTGDGEV-QPLNAAVPEMDIPAIDLNLLLSSSEAGQQELSKLHSALSTWGVVQV 79 
297847230   1 MEKPKFKTVQEVVAAGEGLPERYLHEPTSEGES-QPLNGAVPEMDIPAIDLSLLFSSSEDGREELKKLHSALSTWGVVQV 79 
297808105   1 MEKPKFKTVQEVVAAGEGLPVRYLHVPTGDGEV-QPLNAAVPEMDIPAIDLSLLLSSSEDGREELSKLHSALSTWGVVQV 79 
297796255   1 MEKPKFKTVQELLAAGEKLPERYLCTPTGDGEGdQPFNVSMPEMEIMVIDLSLLLSSSDDGREELSKLHSAISTWGVVQV 80 
15239524   81 MNHGISEALLDKIHELTKQFFVLPTKEKQKYAREISSFQGFGNDMILSDDQVLDWVDRLYLITYPEDQRQLKFWPENPSG 160
15222131   80 MNHGITEAFLDKIYKLTKQFFALPTEEKHKCARETGNIQGYGNDMILSDNQVLDWIDRLFLTTYPEDKRQLKFWPQVPVG 159
15241383   80 INHGITKALLDKIYKLTKEFCALPSEEKQKYAREIGSIQGYGNDMILWDDQVLDWIDRLYITTYPEDQRQLKFWPDVPVG 159
15241348   80 MNHGITKAFLDKIYKLTKEFFALPTEEKQKCAREIDSIQGYGNDMILWDDQVLDWIDRLYITTYPEDQRQLNFWPEVPLG 159
297847230  80 MNHGITEEFLDKIYKLTKQFFALPTEEKHKCARETGNIQGYGNDMILSDNQVLDWIDRLFLTTYPEDKRQLQFWPQVPVG 159
297808105  80 MNHGITEAFLDNIYKLTKEFFALPTEEKQKCAREIGSIQGYGNDMILWDDQVLDWIDRLYITTYPEDQRQLKFWPQVPLG 159
297796255  81 MNHGISEAFLDKILELTRQFFVLPTEEKHKYAREISSFQGFGNDMILSDDQVLDWVDRLYLITYPEDQRQLKFWPKIPSG 160
15239524  161 FRETLHEYTMKQQLVVEKFFKALARSLELEDNCFLEMHGENATLETRFNIYPPCPRPDKVLGLKPHSDGSAFTLILPDKN 240
15222131  160 FSETLDEYTMKQRVLIEKFFKAMARSLELEENCFLEMYGENAVMNSRFNFFPPCPRPDKVIGIKPHADGSAITLLLPDKD 239
15241383  160 FRETLHEYTMKQHLVFNQVFKAMAISLELEENCFLDMCGENATMDTRFNMYPPCPRPDKVIGVRPHADKSAFTLLLPDKN 239
15241348  160 FRETLHEYTMKQRIVIEQFFKAMARSLELEENSFLDMYGESATLDTRFNMYPPCPSPDKVIGVKPHADGSAITLLLPDKD 239
297847230 160 FSETLHEYTMKQRVVIEKFFKAMARSLELEENCFLKMYGENAIMNSRFNFFPPCPRPDKVIGIKPHADGSAITLLLPDKD 239
297808105 160 FKETLHEYTMKQRIVIEQFFKAMARSLELEENSFLDMYGESATMDTRFNMYPPCPRPDKVIGVKPHADGSAFTLLLPDKD 239
297796255 161 FRETLLEYTMKQQLVVEKFFKALARSLGLEDNCFLEMHGENATLETRFNMYPPCPRPDK-------------------KN 221
15239524  241 VEGLQFLKDGKWYKASIL-PHTILINVGDTMEVMSNGIYKSPVHRVVLNGKKERIYVATFCNADEDKEIQPLNGLVSEAR 319
15222131  240 VEGLQFLKDGKWYKAPIV-PDTILITLGDQMEIMSNGIYKSPVHRVVTNREKERISVATFCVPGLDKEIHPADGLVTEAR 318
15241383  240 VEGLQFLKDGKWYKAPVVaSDTILINVGDQMEIMSNGIYKSPVHRVVTNTEKERISVATFCIPGADKEIQPVDGLVSEAR 319
15241348  240 VGGLQFQKDGKWYKAPIV-PDTILINVGDQMEIMSNGIYKSPVHRVVTNREKERISVATFCIPGADKEIQPVNELVSEAR 318
297847230 240 VEGLQFLKDGKWYKAPIV-PDTILINLGDQMEIMSNGIYKSPVHRVVTNREKERISVATFCVPGPDKEIQPANGLVSEAR 318
297808105 240 VEGLQFLKDGKWYKAPIV-PDTILINVGDQMEIMSNGIYKSPVHRVVTNREKERISVATFCIPGADKEIQPVDELVSEAR 318
297796255 222 VDGLQFLKDGKWYKASIL-PHTILINVGDTMEVMSNGIYKSPVHRVVLNNEKARISVVTFCDADEDKEIQPVTELVSEAR 300
15239524  320 PRLYKAVKKSEKNFFDYYQQGRRPIEAAMI 349
15222131  319 PRLYKTVTKYVDLHYKYYQQGRRTIEAALI 348
15241383  320 PRLYKPVKNYVDLLNKYYIQGQRPIAASLI 349
15241348  319 PRLYKTVKKYVELYFKYYQQGRRPIEAALI 348
297847230 319 PRLYKTITKYAELHYKYYQQGRRTIEAALI 348
297808105 319 PRLYKTVKKYVELYFKYYQQGRRPIEAALI 348
297796255 301 PRLYKAVKKSEKNFFNYYQQGRRPIEAAFL 330
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap