Conserved Protein Domain Family
PLN00416

?
PLN00416: PLN00416 
carbonate dehydratase
Statistics
?
PSSM-Id: 177809
View PSSM: PLN00416
Aligned: 6 rows
Threshold Bit Score: 558.882
Threshold Setting Gi: 15223141
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15223141   23 MATESYEAAIKGLNDLLSTKADLGNVAAAKIKALTAELKELDSSNSDAIERIKTGFTQFKTEKYLKNSTLFNHLAKTQTP 102
15220853    1 MSTESYEDAIKRLGELLSKKSDLGNVAAAKIKKLTDELEELDSNKLDAVERIKSGFLHFKTNNYEKNPTLYNSLAKSQTP 80 
42572057    1 MATESYEAAIKGLNDLLSTKADLGNVAAAKIKALTAELKELDSSNSDAIERIKTGFTQFKTEKYLKNSTLFNHLAKTQTP 80 
30698715    1 MATESYEAAIKGLNDLLSTKADLGNVAAAKIKALTAELKELDSSNSDAIERIKTGFTQFKTEKYLKNSTLFNHLAKTQTP 80 
297841793  23 MATESYEAAIKGLNDLLSTKADLGNVAAAKIKALTAELKELDSDNSDAIERIKTGFTQFKTEKYLKNSALFNDLAKGQSP 102
297845422   1 MSTESYEDAIKRLGELLSKNSDLGNVAAAKIKKLTDELEELDSNKLDAVERIKSGFIHFKTNNYEKNPTLHNALAKSQSP 80 
15223141  103 KFLVFACSDSRVCPSHILNFQPGEAFVVRNIANMVPPFDQKRHSGVGAAVEYAVVHLKVENILVIGHSCCGGIKGLMSIE 182
15220853   81 KFLVFACADSRVSPSHILNFQLGEAFIVRNIANMVPPYDKTKHSNVGAALEYPITVLNVENILVIGHSCCGGIKGLMAIE 160
42572057   81 KFLVFACSDSRVCPSHILNFQPGEAFVVRNIANMVPPFDQKRHSGVGAAVEYAVVHLKVENILVIGHSCCGGIKGLMSIE 160
30698715   81 KFLVFACSDSRVCPSHILNFQPGEAFVVRNIANMVPPFDQKRHSGVGAAVEYAVVHLKVENILVIGHSCCGGIKGLMSIE 160
297841793 103 KFLVFACSDSRVCPSHILNFQPGDAFVVRNIANMVPPFDQKRHSGVGAAVEYAVVHLKVENILVIGHSCCGGIKGLMNIE 182
297845422  81 KFLVFACADSRVSPSHILNFQLGEAFIVRNIANMVPPYDKTKHSNVGAALEYPITVLNVENILVIGHSCCGGIKGLMAIE 160
15223141  183 DDAAPTQSDFIENWVKIGASARNKIKEEHKDLSYDDQCNKCEKEAVNVSLGNLLSYPFVRAEVVKNTLAIRGGHYNFVKG 262
15220853  161 DNTAPTKTEFIENWIQICAPAKNRIKQDCKDLSFEDQCTNCEKEAVNVSLGNLLSYPFVRERVVKNKLAIRGAHYDFVKG 240
42572057  161 DDAAPTQSDFIENWVKIGASARNKIKEEHKDLSYDDQCNKCEKEAVNVSLGNLLSYPFVRAEVVKNTLAIRGGHYNFVKG 240
30698715  161 DDAAPTQSDFIENWVKIGASARNKIKEEHKDLSYDDQCNKCEKEAVNVSLGNLLSYPFVRAEVVKNTLAIRGGHYNFVKG 240
297841793 183 DDAAPTQSDFIENWVKIGASARNKIKEEHKDLSYDEQCNKCEKEAVNVSLGNLLSYPFVRAAVVKNTLAIRGGHYNFVKG 262
297845422 161 DDTAPTKTEFIENWIQICAPAKNRIKQECKDLSFEDQCTNCEKEAVNVSLGNLLSYPFVRERVVKNKLSIRGAHYDFVKG 240
15223141  263 TFDLWELDFKTTPAFAFS 280
15220853  241 TFDLWELDFKTTPAFALS 258
42572057  241 TFDLWELDFKTTPAFAFS 258
30698715  241 TFDLWELDFKTTPAFAFS 258
297841793 263 TFDLWELDFKTTPAFAFS 280
297845422 241 TFDLWELDFKTTPAFALS 258
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap