Conserved Protein Domain Family
PLN00415

?
PLN00415: PLN00415 
3-ketoacyl-CoA synthase
Statistics
?
PSSM-Id: 177808
View PSSM: PLN00415
Aligned: 3 rows
Threshold Bit Score: 925.247
Threshold Setting Gi: 297824757
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15226428    1 MFIAMADFKILLLILILISLFELDLLHFHHDFFSPFPVKIGLLLISIFFYAYSTTRSKPVYLVDFSCHQPTDSCKISSET 80 
15228247    1 MFIAMADFKLLLLILILLSLFELDLLHFHHDFFSPFPVKIGLLLISIFFYAYSTTRSKPVYLVDFSCHQPTDSCKISSET 80 
297824757   1 ----MADFKLLLLILILLSLFELDLLHFHHDFFSSFWVKIGLLMISIFFYAYSTTRSKPVYLVDFSCHQPTDSCKISSET 76 
15226428   81 FFNMAKGAQLYTDETIQFMTRILNRSGLGDDTYSPRCMLTSPPTPSMYEARHESELVIFGALNSLFKKTGIEPREVGIFI 160
15228247   81 FFNMAKGAQLYTEETIQFMTRILNRSGLGDDTYSPRCMLTSPPTPSMYEARHESELVIFGALNSLFKKTGIEPREVGIFI 160
297824757  77 FFNMAKGAQLYTEETIQFMTRILNRSGLGDDTYSPRCMLTSPPTPSMYEARHESELVIFGALNSLFKKTGIEPREVGIFI 156
15226428  161 VNCSLFNPNPSLSSMIVNRYKLKTDVKTYNLSGmgcsagaISVDLATNLLKANPNTYAVIVSTENMTLSMYRGNDRSMLV 240
15228247  161 VNCSLFNPNPSLSSMIVNRYKLKTDVKTYNLSG-------ISVDLATNLLKANPNTYAVIVSTENMTLSMYRGNDRSMLV 233
297824757 157 VNCSLFNPNPSLSSMIVNRYKLKTDVKTYNLSGmgcsagaISVDLATNLLKANPNTYAVIVSTENMTLSMYRGNDRSMLV 236
15226428  241 PNCLFRVGGAAVMLSNRSQDRVRSKYELTHIVRTHKGSSDKHYTCAEQKEDSKGIVGVALSKELTVVAGDSLKTNLTALG 320
15228247  234 PNCLFRVGGAAVMLSNRSQDRVRSKYELTHIVRTHKGSSDKHYTCAEQKEDSKGIVGVALSKELTVVAGDTLKTNLTALG 313
297824757 237 PNCLFRVGGAAVLLSNRSQDRFRSKYELTHLVRTHKGSSDKHYTCAEQKEDNKGIVGVALSKELTVVAGDTLKTNLTALG 316
15226428  321 PLVLPLSEKLRFILFLVKSKLFRLKVSPYVPDFKLCFKHFCIHAGGRALLDAVEKGLGLSEFDLEPSRMTLHRFGNTSSS 400
15228247  314 PLVLPLSEKLRFILFLVKSKLFRLKVSPYVPDFKLCFKHFCIHAGGRALLDAVEKGLGLSEFDLEPSRMTLHRFGNTSSS 393
297824757 317 PLVLPLSEKLRFIIFMVKSKLFRLKASPYVPDFKLCFKHFCIHAGGRALLDAVEKGLGLSEFDLEPSRMTLHRFGNTSSS 396
15226428  401 SLWYELAYVEAKCRVKRGDRVWQLAFGSGFKCNSIVWRALRTIPANESLVGNPWGDSVHKYPVHVT 466
15228247  394 SLWYELAYVEAKCRVKRGDRVWQLAFGSGFKCNSIVWRALRTIPANESLVGNPWGDSVHKYPVHVT 459
297824757 397 SLWYELAYVEAKCRVKRGDRVWQLAFGSGFKCNSIVWRALRTIPANESLVGNPWGDSVHKYPVHVT 462
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap