Conserved Protein Domain Family
PLN00414

?
PLN00414: PLN00414 
glycosyltransferase family protein
Statistics
?
PSSM-Id: 177807
View PSSM: PLN00414
Aligned: 3 rows
Threshold Bit Score: 954.085
Threshold Setting Gi: 297847402
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15230017    1 MGSKFHAFLYPWFGFGHMIPYLHLANKLAEKGHRVTFLAPKKAQKQLEPLNLFPNSIHFENVTLPHVDGLPVGAETTADL 80 
15223589    1 MGSKFHAFMYPWFGFGHMIPYLHLANKLAEKGHRVTFFLPKKAHKQLQPLNLFPDSIVFEPLTLPPVDGLPFGAETASDL 80 
297847402   1 MGSKFHAFMYPWFGFGHMIPYLHLANKLAEKGHTITFFLPKKAHKQLQPLNLFPDSIVLEPLSLPPADGLPFGAETASDL 80 
15230017   81 PNSSKRVLADAMDLLREQIEVKIRSLKPDLIFFDFVDWIPQMAKELGIKSVSYQIISAAFIAMFFAPRAELGSPPPGFPS 160
15223589   81 PNSTKKPIFVAMDLLRDQIEAKVRALKPDLIFFDFVHWVPEMAEEFGIKSVNYQIISAACVAMVLAPRAELGFPPPDYPL 160
297847402  81 PNSTKKPIFLAMDLLRDQIEAKVLALKPDLIFFDFVHWVPEMAKEFGIKSVNYQIISAACVAMVLAPSAELGFPPPDYPL 160
15230017  161 SKVALRGHDANIYSLFANTRKfLFDRVTTGLKNCDVIAIRTCAEIEGNLCDFIERQCQRKVLLTGPMFLDPQGKSGKPLE 240
15223589  161 SKVALRGHEANVCSLFANSHE-LFGLITKGLKNCDVVSIRTCVELEGKLCGFIEKECQKKLLLTGPMLPEPQNKSGKFLE 239
297847402 161 SKVALRGHDANVCSLFANSHE-LFGLITKGLKNCDVVSIRTCVELE------------------GPMLPEPQNKSGKPLE 221
15230017  241 DRWNNWLNGFEPSSVVYCAFGTHFFFEIDQFQELCLGMELTGLPFLVAVMPPRGSSTIQEALPEGFEERIKGRGIVWGGW 320
15223589  240 DRWNHWLNGFEPGSVVFCAFGTQFFFEKDQFQEFCLGMELMGLPFLISVMPPKGSPTVQEALPKGFEERVKKHGIVWEGW 319
297847402 222 DRWNHWLNVFEPGSVVFCAFGTQFFFEKDQFQEFCLGMELTGLPFLIAVMPPKGSSTVQEALPEGFEERVKGRGIVWEGW 301
15230017  321 VEQPLILSHPSIGCFVNHCGFGSMWESLVSDCQIVFIPQLVDQVLTTRLLTEELEVSVKVKRDEiTGWFSKESLRDTVKS 400
15223589  320 LEQPLILSHPSVGCFVNHCGFGSMWESLVSDCQIVFIPQLADQVLITRLLTEELEVSVKVQRED-SGWFSKEDLRDTVKS 398
297847402 302 VEQPLILSHPSVGCFVNHCGFGSMWESLVSDCQIVFIPQLADQVLITRLLTEELQVSVKVQRED-SGWFSKENLRDAVKS 380
15230017  401 VMDKNSEIGNLVRRNHKKLKETLVSPGLLSSYADKFVDELENHIHSKN 448
15223589  399 VMDIDSEIGNLVKRNHKKLKETLVSPGLLSGYADKFVEALEIEVNNTK 446
297847402 381 VMDRDSEIGNLVKKNHKKLKDTLVSPGLLSGCADKFVEALENEVNNTK 428
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap