Conserved Protein Domain Family
PLN00413

?
PLN00413: PLN00413 
triacylglycerol lipase
Statistics
?
PSSM-Id: 165792
View PSSM: PLN00413
Aligned: 2 rows
Threshold Bit Score: 1026.88
Threshold Setting Gi: 240256390
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
240254290   1 MVQPKNYFVLDPREATVTDLMRLLFYSDLENRKFVDTSVENLENRLCEFRGRWIIFVSIVVQKLLIILRKPLSFLGFALG 80 
240256390   1 MSRTKNYFVLDPREATVSDLIHLLFSSDLGDRKFIHSSEERIEDDLSRFRRRWIIFVSIVIQKLIILFKKPLYFVGFSLA 80 
240254290  81 FWLNLPSSNGGFFKIFLNLVKGRFIWPEKTSATFASINGNLDQKVElgLGRSIKIGDERYKPLLSIMASKLAYENEHFIR 160
240256390  81 CWLNLLSSNGGFLMILPNLFKGNIIWPEKASATFASLNGNLDRRVE--LNPKVERGSKRYKAMLSIMASKLSYENINFVS 158
240254290 161 SVLQDHWQMDLLGFYSCPNDFDQTRSTEVIVIRDTKDNPNLIVVSFRGTDPFNADDWCTDLDLSWHNVMNVGKIHGGFMK 240
240256390 159 SVLHNHWKMDLLGFYSCWNGYQKQRSTEVIVIKDTSTDPNLIIVSFRGTDPFDADDWCTDLDLSWYEVKNVGKIHGGFMK 238
240254290 241 ALGLPKEGWYEEINSDQTQNKTSQLAYYTILRQLKEVFEQNPTSKFILSGHSLGGALAILFTAVLIMHDEKEMLERLEGV 320
240256390 239 ALGLQKEGWPKEVNLDETQNATTLYAYYTVRRHLKEILDQNPTSKFILTGHSLGGALAILFTAVLVMHDEEQMLERLEGV 318
240254290 321 YTFGQPRVGDEDFGIYMKDKLKEFDVKYKRYVYCNDMVPRLPFDDKTLMFKHFGGCLYCDSFYKGKVEEEEPNKNYFNIF 400
240256390 319 YTFGQPRVGDEEFGNFMKDSLKKFDVKYERYVYCNDMVPRLPFDDKTLMFKHFGACLYYDSFYKGKVEEEEPNKNYFNLV 398
240254290 401 WVIPKIINAVWELIRSFIISCWQGREYREGWLLTCFRLVALLIPGLPAHFPNEYVNVALLGnfppqvpdsqNLPDDDLN 479
240256390 399 WVLPKIMNALWELIRSFVMPYWKGGEFREGWFLRCFRVVALLIPGLPAHFPNEYINVTLLG----------DLPDSHLD 467
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap