Conserved Protein Domain Family
PLN00411

?
PLN00411: PLN00411 
nodulin MtN21 family protein; Provisional
Statistics
?
PSSM-Id: 177805
View PSSM: PLN00411
Aligned: 6 rows
Threshold Bit Score: 571.514
Threshold Setting Gi: 30689045
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18405642    1 MAGAVSLWRREAVFLTAMLAGETSIVGLSTLFKVATSKGLNIYPFLSYSYLLASLLLLPSLFFTNRSRSLPPLSASILSK 80 
22331380    4 MAGTASPWRREAVFLTAMLVVETSVVGISTLFKFATSKGLNIYPFLGYSYLLASLLLLPSLFFTNRSSSLPPLSVSILSK 83 
42565258    1 MARTVSLWRREAVFLTAMLATETGVVGISTLFKVATSKGLNLYAFLGYSYLLASLLLLPSLFFTDRSRSLPPLSLSILSK 80 
30689045    1 MAGAVSLWRREAVFLTAMLAGETSIVGLSTLFKVATSKGLNIYPFLSYSYLLASLLLLPSLFFTN--------SASILSK 72 
297815080   1 MAGAVSLWRREAMFLTAMLAVETSVVGISTLFKVATSKGLNIYPFLGYSYLLASLLLLPSLFFTNRSRSLPSLSVSILCK 80 
297815082   1 MAGTLSLWRREALFLTAMLATETGVVGMSTLFKVATSKGLNLYAFLGYSYLLASLVLLPSFFFSNRSRSLPPLSFAILCK 80 
18405642   81 IGLLGFLGSMYVITGGIGIEYSNPTLASAIGNIVPALTFILAVIFRMEKVSFKERSSVAKVMGTILSLIGAFVVIFYHGP 160
22331380   84 IGLLGFLGSMYVITGYIGIEYSSPTLASAINNITPALTFILAIIFRMEKVSFKERSSLAKLMGTILSLIGALVVIFYHGP 163
42565258   81 IGLLGLLGSMYVITGYIGIEYSSPTLASAISNITPALTFILAIIFRMEKVSFKERSSVAKVMGTILSLIGALVVVLYHGP 160
30689045   73 IGLLGFLGSMYVITGGIGIEYSNPTLASAIGNIVPALTFILAVIFRMEKVSFKERSSVAKVMGTILSLIGAFVVIFYHGP 152
297815080  81 IGLLGFLGSMYVITGYIGIEYSSPTLASAINNITPALTFILAVIFRMEKVSFKERSSVAKVMGTILSLIGALVVIFYRGP 160
297815082  81 IGLLGLLGSMYVITGYIGIKYSNPTLASAISNITPALTFILAIIFRMEKVSFKERSSVAKVIGTILSLIGALVVVLYHGP 160
18405642  161 RVFVASSPPYLNFRQLSPPLSSSKSDWLIGGAILTIQGIFVSVSFILQTHIMREYPEAFTVSILYILCISIVTSMIGLVV 240
22331380  164 RVFLASSPPYVNFRQFSPPLSSSNSDWLIGGALLTMQGIFVSVSFILQAHIMSVYPAAFRVSFLYTVCVSIVTSTIGLVV 243
42565258  161 RVFVASSPPYINFRQLSPPLSSSNSDWLIGGALLTIRDIFVSVSFILQAKIMSTYPAAFTVSFLYIVSVSIVTSMIGLVV 240
30689045  153 RVFVASSPPYLNFRQLSPPLSSSKSDWLIGGAILTIQGIFVSVSFILQTHIMREYPEAFTVSILYILCISIVTSMIGLVV 232
297815080 161 RVSVASSPPYLNFRQHSPPLSSSNSDWLIGGALLTIQGIFVSVSFILQAHIMSEYPAAFRVSFLYTVCVSIVTSTIGLVA 240
297815082 161 RVFIASSPPYLNFRQLPPPLSSSNSDWLIGGALLTTRDIFVSVSFILQAQIMSEYPAAFTVSFLYTVSVSIVTSVIGLVV 240
18405642  241 EKNNPSIWIIHFDITLFTIVTTGIITSVYYVIHSWAIRHKRPLYLAIFKPLSILIAVVMGTIFLNDSLYLGCLIGGILIT 320
22331380  244 EKNNPSVWIIHFDITLITIVTMAIVTSVYYVIHSWTVRHKGPLYLAIFKPLSILIAVVMGAIFLNDSLYLGCLIGGILIT 323
42565258  241 EKNNPSVWIIRFDITLITIVTMAIITSVYYVIHSWTVRHKGPLYLAIFKPLSILIAVVMSAVFLNDSLYLGCLIGGLLIT 320
30689045  233 EKNNPSIWIIHFDITLFTIVTTGIITSVYYVIHSWAIRHKRPLYLAIFKPLSILIAVVMGTIFLNDSLYLGCLIGGILIT 312
297815080 241 EKNNPSVWIIHFDITLITIVTMAIITSVYYVIHSWTVRHKGPLYLAIFKPLSILIAVVMGGIFLNDSLYLGCLIGGILIS 320
297815082 241 EKNNPSVWIIRFDITLITIVTMAIVTSVYYVIHSWTVSHKGPLYLAIFKPLSILIAVVMSAVFLNDSLYLGCLIGGVVIT 320
18405642  321 LGFYVVMWGKANEEKNKlLSFSGKEKTPLLLSGKNDQI 358
22331380  324 LGFYAVMWGKANEEKDQ-LSFSEKEKTPLLLNRKNDQV 360
42565258  321 LGFYAVMWGKANEEKDQlLLVSGKERTPLLLNG----- 353
30689045  313 LGFYVVMWGKANEEKNKlLSFSGKEKTPLLLSGKNDQI 350
297815080 321 LGFYAVMWGKANEEKDQlLSFSGKEKTPLLLSGENDQI 358
297815082 321 LGFYAVMWGKANEEKDQlL-LSEKEKTPLLLNGYNDQI 357
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap