Conserved Protein Domain Family
PLN00223

?
PLN00223: PLN00223 
ADP-ribosylation factor; Provisional
Statistics
?
PSSM-Id: 165788
View PSSM: PLN00223
Aligned: 63 rows
Threshold Bit Score: 387.015
Threshold Setting Gi: 223993519
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219111535   1 MGLTFSRVWERMFGKKEMRILMVGLDAAGKTTILYKLKLGEVVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH 80 
159465365   1 MGLMVSKALSRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH 80 
159466569   1 MGLMVSKALSRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH 80 
224108844   1 MGLSFTKLLGRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH 80 
224084398   1 MGMAISRLVKLLFARKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNVSFTVWDVGGQDKIRPLWRH 80 
225438827   1 MGLVISRLLKMLFAKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNVSFTVWDVGGQHKIRPLWRH 80 
255567885   1 MGMAISRLIKLLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNVSFTVWDVGGQDKIRPLWRH 80 
302833537   1 MGLIISKALSRLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH 80 
302783252   1 MGLSFAKLFQRFLGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH 80 
302789484   1 MGLSFAKLFQRFLGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRH 80 
219111535  81 YYQNTQGLIFVVDSNDSDRIDAARDELHRMLNEDELRDAVLLVFANKQDLPNAMSAAEMTDKLGLHGLRPsyRQWYIQAC 160
159465365  81 YFQNTQGLIFVVDSNDRDRIGEAKDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITEKLGLHGLRQ--RHWYIQST 158
159466569  81 YFQNTQGLIFVVDSNDRDRIGEAKDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITEKLGLHGLRQ--RHWYIQST 158
224108844  81 YFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQ--RHWYIQST 158
224084398  81 YFQNTQGLIFVVDSNDRERVTEARDELHRMLSEDELRDATLLIFANKQDLPNAMSVSEITDKLGLHSLRQ--RRWYIQAA 158
225438827  81 YFQNTQGLIFVVDSNDRERILEAKDELHRMLSEDELRDATLLVFANKQDLPNAMSVSEITDKMGLHSLRQ--RRWYIQST 158
255567885  81 YFQNTQGLIFVVDSNDRERISEARDELQRMLSEDELRDATLLVFANKQDLPNAMTVSEVTDKLGLHSLRQ--RRWYIQAT 158
302833537  81 YFQNTQGLIFVIDSNDRERVGEAKDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITEKLGLHGLRH--KCWYIQST 158
302783252  81 YFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELREAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQ--RHWYIQST 158
302789484  81 YFQNTQGLIFVVDSNDRDRVGEARDELHRMLNEDELREAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQ--RHWYIQST 158
219111535 161 CATTGDGLYEGLDWLSATLVKRN 183
159465365 159 CATSGEGLYEGLDWLSQNIQNKS 181
159466569 159 CATSGEGLYEGLDWLSQNIQNKS 181
224108844 159 CATSGEGLYEGLDWLSNNISSKA 181
224084398 159 CATSGQGLYEGLDWLSSNISSKA 181
225438827 159 CATSGQGLYEGLDWLSSNISSKA 181
255567885 159 CATSGQGLYEGLDWLSSNISSKA 181
302833537 159 CATSGEGLYEGLDWLSQNIAAKS 181
302783252 159 CATSGEGLYEGLDWLSNNIVTKS 181
302789484 159 CATSGEGLYEGLDWLSNNIVTKS 181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap