Conserved Protein Domain Family
PLN00221

?
PLN00221: PLN00221 
tubulin alpha chain; Provisional
Statistics
?
PSSM-Id: 177802
View PSSM: PLN00221
Aligned: 84 rows
Threshold Bit Score: 901.868
Threshold Setting Gi: 30683070
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302786248   1 MREIISIHVGQAGIQLGNSCWELFCLEHGIQPNGKAidrndHQEAMAGATKESFGTFFSEAASAtKHVPRAVMVDLEPTV 80 
115451599   1 MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLM-----PSDTTPGIARDAFNTFFSETSSG-KHVPRALFVDLEPTV 74 
15217737    1 MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTM-----PSDSTVGACHDAFNTFFSETSSG-QHVPRAVFLDLEPTV 74 
162606336   1 MREVLSIHIGQAGIQVGNACWELYCLEHGINPDGSI-----IQDFNKKKNDDAFSTFFSETSTG-KRVPRCVFLDLESGV 74 
224125842   1 MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTM-----PSDTSVGVEHDSFNTFFSETGSG-KHVPRAIFVDLEPSV 74 
225441593   1 MREVISIHIGQAGIQVGNECWELFCLEHGIQSDGMM-----PSGTSNGAGHDAFNTFFSETDAG-KYVPRAVFVDLEPSV 74 
242036477   1 MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGLM-----PSDNSVGVARDAFNTFFSETSAG-KHVPRALFVDLEPTV 74 
255568892   1 MREVISIHIGQAGIQVGNSCWELYCLEHGIQPDGLM-----SSDTSIGSEHDSFNTFFSETGSG-KHVPRAIFVDLEPTV 74 
297837743   1 MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGTM-----PSDSTVGVCHDAFNTFFSETSSG-QHVPRAVFLDLEPTV 74 
302814445   1 MREIISIHVGQAGIQLGNSCWELFCLEHGIQPNGKAidrndHQEAMAGATKESFGTFFSEAASAtKHVPRAVMVDLEPTV 80 
302786248  81 IDEIRTGSYRELFHPDQLISGKEDAANNFARGHYTVGREILEQCLDRIRKLADNCSGLQGFLVFNAVGGGTGSGLGALLL 160
115451599  75 IDEVKTGPYRQLFHPEQLISYKEDAANNFARGHYTVGREVVDLCLDRLRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLL 154
15217737   75 IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDTCLERLRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLL 154
162606336  75 IDEVKNGRYKNLYHPEQLICGNEDAANNYARGHYTIGKEIIEIALDRIRKLVENCSGLQGFLIFNSVGGGTGSGLGSLLL 154
224125842  75 IDEVRSGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVELCLDRVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLL 154
225441593  75 IDEVRTGVYKQLFHPEQLISGKEDAANNYARGHYTVGKDIVDLCLDRVRKLADVCSGLQGFLVFNAVGGGTGSGFGSLVL 154
242036477  75 IDEVKTGAYRQLFHPEQLISHKEDAANNFARGHYTVGREVVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLL 154
255568892  75 IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDLCLDRVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLL 154
297837743  75 IDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGREIVDTCLERLRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLL 154
302814445  81 IDEIRTGSYRELFHPDQLISGKEDAANNFARGHYTVGREILEQCLDRIRKLADNCSGLQGFLVFNAVGGGTGSGLGALLL 160
302786248 161 ERLTCDYGRKSKLGFSIYPSPKISTAVVEPYNSVLATHALLEHSDVVAVLDNEAIYDICRKSLNIERPSYTNLNRLVSQV 240
115451599 155 ERLSVDYGRKSKLGFTIYPSPQISTAVVEPYNSVLSTHSLIEHTDVVVLLDNEAIYDICKRSLDIERPTYTNLNRLISQV 234
15217737  155 ERLSVDFGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVVVLLDNEAIYDICRRSLDIERPTYSNLNRLISQT 234
162606336 155 ERLSLDYGKKSKLGFTVYPSPQVSTAVVEPYNSVLATHSLLEHTDVAVVLDNEAIYEICQRSLNIERPTYTNLNRLIAQV 234
224125842 155 ERLSVDYGKKSKLGFTIFPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYNNLNRLISQI 234
225441593 155 ERLSADYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDLERPTYTNLNRLISQI 234
242036477 155 ERLSVDYGRKSKLGFTIYPSPQISTAVVEPYNSVLSTHSLIEHTDVVVLLDNEAIYDICKRSLDIERPTYTNLNRLISQV 234
255568892 155 ERLSVDYGKKSKLGFTIFPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRKSLDIERPTYTNLNRLISQI 234
297837743 155 ERLSVDFGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVVVLLDNEAIYDICRRSLDIERPTYTNLNRLISQT 234
302814445 161 ERLTCDYGRKSKLGFSIYPSPKISTAVVEPYNSVLATHALLEHSDVVAVLDNEAIYDICRKSLNIERPSYTNLNRLVSQV 240
302786248 241 ISSLTTSLRFNGALNVDISEFQTNLVPFPRIHFMLSSYAPVISAERAFHEQLSVSEITTSVFEPASMMAKCDPRHGKYMA 320
115451599 235 ISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPIISVEKAFHEQHSVPEITNSVFEPASVMAKCDPRHGKYMA 314
15217737  235 ISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISSAKAYHEQFSVPEITTSVFEPSNMMAKCDPRHGKYMA 314
162606336 235 ISSITASLRFDGALNVDITEFQTNLVPYPRIHFMLSSLAPVISLEMANHEQYSTAEITNAAFEPNSMMAKCDPRRGKYMA 314
224125842 235 ISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMA 314
225441593 235 ISSITTSLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKVYHEQLSVPEITTAVFEPSSMMAKCDPRHGKYMA 314
242036477 235 ISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPIISVEKAYHEQHSVPEITNSVFEPSSVMAKCDPRHGKYMA 314
255568892 235 ISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAFHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMA 314
297837743 235 ISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISSAKAYHEQFSVSEITTSVFEPSNMMAKCDPRHGKYMA 314
302814445 241 ISSLTTSLRFNGALNVDISEFQTNLVPFPRIHFMLSSYAPVISAERAFHEQLSVSEITTSVFEPASMMAKCDPRHGKYMA 320
302786248 321 CCMMYRGDLTPKEVQQAVSNIRTKRSVQFVDWCPTGFKCGINYQPPTAVPNGDLARVKRAVCMISNNTAVADVFSHINHK 400
115451599 315 CCLMYRGDVVPKDVNAAVHSIKTRRTVQFVDWCPTGFKCGINYQPPTAVPGGDLAKVRRAVCMISNNTAVAEVFSRIDRK 394
15217737  315 CCLMYRGDVVPKDVNTAVAAIKAKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK 394
162606336 315 CCLMFRGDVAPKDVNGSVAAIKTKKTIQFVDWCPTGFKCGINYQPPTVVPDGDLAKVDRAVCMISNSTAISEVFSRINKK 394
224125842 315 CCLMYRGDVVPKDVNSAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDYK 394
225441593 315 CCLMYRGDVVPKDVNASVANIKTKRTVQFVDWCPTGFKCGINYQAPTAVPGAELAKVKRAVCMISNNTAVAEVFERITHK 394
242036477 315 CCLMYRGDVVPKDVNAAVHSIKTKRAVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDRK 394
255568892 315 CCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK 394
297837743 315 CCLMYRGDVVPKDVNTAVAAIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK 394
302814445 321 CCMMYRGDLTPKEVQQAVSNIRTKRSVQFVDWCPTGFKCGINYQPPTAVPNGDLARVKRAVCMISNNTAVADVFSHINHK 400
302786248 401 FDLMFSKRAFVHWYVGEGMEEGEFSEAREDVAALEKDYAEVAQDGDEDEQsqVNGAEA 458
115451599 395 FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAEVEDDD---EEQGEY 449
15217737  395 FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGGEGAEDDD--EEGDEY 450
162606336 395 FDLMYSKRAFVHWYVGEGMEEGEFNEAREDMAALEKDYEEVGSESQD-----LISNSF 447
224125842 395 FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAEGGDEE---GEEEDY 449
225441593 395 FDLMYVKRAFVHWYVGEGMEEGEFSEAREDLATLEKDYEEVVAEAID-----IEAEE- 446
242036477 395 FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAEVEDD----DEEAEY 448
255568892 395 FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAEGAEDE---DEGEDY 449
297837743 395 FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAEGAEDDD--EEGDEY 450
302814445 401 FDLMFSKRAFVHWYVGEGMEEGEFSEAREDVAALEKDYAEVAQDGDEDEQsqVNGAEA 458
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap