Conserved Protein Domain Family
PLN00219

?
PLN00219: PLN00219 
predicted protein; Provisional
Statistics
?
PSSM-Id: 165784
View PSSM: PLN00219
Aligned: 6 rows
Threshold Bit Score: 107.297
Threshold Setting Gi: 162605948
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
162605948  1 MTDRHPSCHPYSPVFNFYQEKKEMFTHSSAKQVTRMPDSKERSKTHLSQHPEESLDQFTITKGQN 65 
162605952  1 MTDRHPSCHPYSPVFNFYQEKKEMFTHSSAKQVTRMPDSKERSKTHLSQHPEESLDQFTITKGQN 65 
162606292  1 MTDRHPSCHPYSPVFNFYQEKKEMFTHSSAKQVTRMPDSKERSKTHLSQHPEESLDQFTITKGQN 65 
162606268  1 MTDRHPSCHPYSPVFNFYQEKKEMFTHSSAKQVTRMPDSKERSKTHLSQHPEESLDQFTITKGQN 65 
162606264  1 MTDRHPSCHPYSPVFNFYQEKKEMFTHSSAKQVTRMPDSKERSKTHLSQHPEESLDQFTITKGQN 65 
162606602  1 MTDRHPSCHPYSPVFNFYQEKKEMFTHSSAKQVTRMPDSKERSKTHLSQHPEESLDQFTITKGQN 65 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap