Conserved Protein Domain Family
PLN00218

?
PLN00218: PLN00218 
predicted protein; Provisional
Statistics
?
PSSM-Id: 165783
View PSSM: PLN00218
Aligned: 6 rows
Threshold Bit Score: 237.964
Threshold Setting Gi: 162606604
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
162606604   1 MRRERVCSYFPYFRYFFLFFFFFFWRESSLVFLFFFFLAFHEEVLVCFDVFIWRLFPPLGSISLILNVLLPALGFCGFQR 80 
162606262   1 MRRERVCSYFPYFRYFFLFFFFFFWRESSLVFLFFFFLAFHEEVLVCFDVFIWRLFPPLGSISLILNVLLPALGFCGFQR 80 
162606290   1 MRRERVCSYFPYFRYFFLFFFFFFWRESSLVFLFFFFLAFHEEVLVCFDVFIWRLFPPLGSISLILNVLLPALGFCGFQR 80 
162606276   1 MRRERVCSYFPYFRYFFLFFFFFFWRESSLVFLFFFFLAFHEEVLVCFDVFIWRLFPPLGSISLILNVLLPALGFCGFQR 80 
162605960   1 MRRERVCSYFPYFRYFFLFFFFFFWRESSLVFLFFFFLAFHEEVLVCFDVFIWRLFPPLGSISLILNVLLPALGFCGFQR 80 
162605946   1 MRRERVCSYFPYFRYFFLFFFFFFWRESSLVFLFFFFLAFHEEVLVCFDVFIWRLFPPLGSISLILNVLLPALGFCGFQR 80 
162606604  81 GGSSWVVERCVISFFFLILSLRGRWSLDRKMCKRKACPSLRGERRDSSSSLSRPWVGCSIHLSISLRHPMV 151
162606262  81 GGSSWVVERCVISFFFLILSLRGRWSLDRKMCKRKACPSLRGERRDSSSSLSRPWVGCSIHLSISLRHPMV 151
162606290  81 GGSSWVVERCVISFFFLILSLRGRWSLDRKMCKRKACPSLRGERRDSSSSLSRPWVGCSIHLSISLRHPMV 151
162606276  81 GGSSWVVERCVISFFFLILSLRGRWSLDRKMCKRKACPSLRGERRDSSSSLSRPWVGCSIHLSISLRHPMV 151
162605960  81 GGSSWVVERCVISFFFLILSLRGRWSLDRKMCKRKACPSLRGERRDSSSSLSRPWVGCSIHLSISLRHPMV 151
162605946  81 GGSSWVVERCVISFFFLILSLRGRWSLDRKMCKRKACPSLRGERRDSSSSLSRPWVGCSIHLSISLRHPMV 151
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap