Conserved Protein Domain Family
PLN00217

?
PLN00217: PLN00217 
predicted protein; Provisional
Statistics
?
PSSM-Id: 165782
View PSSM: PLN00217
Aligned: 6 rows
Threshold Bit Score: 385.733
Threshold Setting Gi: 162605944
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
162605944   1 MVRIFKRREMGWNVQPTSRGSTGHLLRRILKTRHGQLNNYRIQHPIRPGSPCAERIVSNRCRERTPLTKLVATTRLQGIT 80 
162605958   1 MVRIFKRREMGWNVQPTSRGSTGHLLRRILKTRHGQLNNYRIQHPIRPGSPCAERIVSNRCRERTPLTKLVATTRLQGIT 80 
162606274   1 MVRIFKRREMGWNVQPTSRGSTGHLLRRILKTRHGQLNNYRIQHPIRPGSPCAERIVSNRCRERTPLTKLVATTRLQGIT 80 
162606288   1 MVRIFKRREMGWNVQPTSRGSTGHLLRRILKTRHGQLNNYRIQHPIRPGSPCAERIVSNRCRERTPLTKLVATTRLQGIT 80 
162606260   1 MVRIFKRREMGWNVQPTSRGSTGHLLRRILKTRHGQLNNYRIQHPIRPGSPCAERIVSNRCRERTPLTKLVATTRLQGIT 80 
162606606   1 MVRIFKRREMGWNVQPTSRGSTGHLLRRILKTRHGQLNNYRIQHPIRPGSPCAERIVSNRCRERTPLTKLVATTRLQGIT 80 
162605944  81 STPREWYPWSQRLLSPRSSYKEEARGEEDNMPRRPPCSPLNWTLRPEESDYSNTHTDSNRTRAANLREGHQKGSSDGKPS 160
162605958  81 STPREWYPWSQRLLSPRSSYKEEARGEEDNMPRRPPCSPLNWTLRPEESDYSNTHTDSNRTRAANLREGHQKGSSDGKPS 160
162606274  81 STPREWYPWSQRLLSPRSSYKEEARGEEDNMPRRPPCSPLNWTLRPEESDYSNTHTDSNRTRAANLREGHQKGSSDGKPS 160
162606288  81 STPREWYPWSQRLLSPRSSYKEEARGEEDNMPRRPPCSPLNWTLRPEESDYSNTHTDSNRTRAANLREGHQKGSSDGKPS 160
162606260  81 STPREWYPWSQRLLSPRSSYKEEARGEEDNMPRRPPCSPLNWTLRPEESDYSNTHTDSNRTRAANLREGHQKGSSDGKPS 160
162606606  81 STPREWYPWSQRLLSPRSSYKEEARGEEDNMPRRPPCSPLNWTLRPEESDYSNTHTDSNRTRAANLREGHQKGSSDGKPS 160
162605944 161 RPKTLSFSHNIQQKRTRIRHLTSPLQRLEKGGTSSSRTHTLFPIVKPLGV 210
162605958 161 RPKTLSFSHNIQQKRTRIRHLTSPLQRLEKGGTSSSRTHTLFPIVKPLGV 210
162606274 161 RPKTLSFSHNIQQKRTRIRHLTSPLQRLEKGGTSSSRTHTLFPIVKPLGV 210
162606288 161 RPKTLSFSHNIQQKRTRIRHLTSPLQRLEKGGTSSSRTHTLFPIVKPLGV 210
162606260 161 RPKTLSFSHNIQQKRTRIRHLTSPLQRLEKGGTSSSRTHTLFPIVKPLGV 210
162606606 161 RPKTLSFSHNIQQKRTRIRHLTSPLQRLEKGGTSSSRTHTLFPIVKPLGV 210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap