Conserved Protein Domain Family
PLN00215

?
PLN00215: PLN00215 
predicted protein; Provisional
Statistics
?
PSSM-Id: 165780
View PSSM: PLN00215
Aligned: 6 rows
Threshold Bit Score: 200.046
Threshold Setting Gi: 162605942
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
162605942   1 MKNIKGGKTRAGKPKKNDLTTRYTRPAPIDEPNRGKGCTMHLSLPPPMSKRRSAAKMIPGQGGQWVLRRGTSRDCKPDLP 80 
162605956   1 MKNIKGGKTRAGKPKKNDLTTRYTRPAPIDEPNRGKGCTMHLSLPPPMSKRRSAAKMIPGQGGQWVLRRGTSRDCKPDLP 80 
162606258   1 MKNIKGGKTRAGKPKKNDLTTRYTRPAPIDEPNRGKGCTMHLSLPPPMSKRRSAAKMIPGQGGQWVLRRGTSRDCKPDLP 80 
162606272   1 MKNIKGGKTRAGKPKKNDLTTRYTRPAPIDEPNRGKGCTMHLSLPPPMSKRRSAAKMIPGQGGQWVLRRGTSRDCKPDLP 80 
162606286   1 MKNIKGGKTRAGKPKKNDLTTRYTRPAPIDEPNRGKGCTMHLSLPPPMSKRRSAAKMIPGQGGQWVLRRGTSRDCKPDLP 80 
162606608   1 MKNIKGGKTRAGKPKKNDLTTRYTRPAPIDEPNRGKGCTMHLSLPPPMSKRRSAAKMIPGQGGQWVLRRGTSRDCKPDLP 80 
162605942  81 MATSSCAPISKTERLWPRRWAWDTRFLNTS 110
162605956  81 MATSSCAPISKTERLWPRRWAWDTRFLNTS 110
162606258  81 MATSSCAPISKTERLWPRRWAWDTRFLNTS 110
162606272  81 MATSSCAPISKTERLWPRRWAWDTRFLNTS 110
162606286  81 MATSSCAPISKTERLWPRRWAWDTRFLNTS 110
162606608  81 MATSSCAPISKTERLWPRRWAWDTRFLNTS 110
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap