Conserved Protein Domain Family
PLN00213

?
PLN00213: PLN00213 
predicted protein; Provisional
Statistics
?
PSSM-Id: 165778
View PSSM: PLN00213
Aligned: 29 rows
Threshold Bit Score: 196.768
Threshold Setting Gi: 145334591
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
145332735   1 MSIKNVFSLLYVLCIIVSVNAQLPQFPAQLPFPFPFQLISGLPDITKCWSSVMDIPGCIAEISQSIFTGKFGNLGPACCK 80 
145334591   1 MSIKNVFSLLAVLCIIVSVNAQLPQFPAQLPFLFPFQLIPGLPDITKCFSSVMDIPGCIAEISQSIFTGKFGNLGPTCCK 80 
145334593   1 MSIKNVFSLLAVLCIIVSVNAQLSQFPAQLPFPFPFQLIPGLPDITKCFSSVMDIPGYIAEISQSIFTGKFDNLGPACCK 80 
145334595   1 MSIKNVFSLLAVLCIIVSVNAQLPQFPAQLPFLFPFQLIPGLPDITKCFSSVMDIPGCIAEISQSIFTGKFGNLGPTCCK 80 
145334601   1 MSIKNVFSLLAVLCIIVSVNAQLPQFPAQLPFLFPFQLIPGLPDITKCFSSVMDIPGCIAEISQSIFTGKFGNLGPACCK 80 
145334631   1 MSIKNVFSLLAVLCIIVSVNAQLPQFPAQLPFLFPFQLIPGLPDITKCFSSVMDIPGCIAEISQSIFTGKFGNLGPTCCK 80 
145334637   1 MFIKNVFSVLAVLCIIVSVNAQLPQYPAQLPFPFPFQLIPGLPDITKCFSSVMDIPGCIAEISQSIFTGKFGNLGPACCK 80 
145334641   1 MSIKNVFSLLAVLCIIVSVNAQLPQFPAQLPFPFPFQLIPGLPDITKCFSSVMDIPECIAEISQSIFTGKFGNLSPACCK 80 
145334643   1 MSIKNVFSLLAVLCIIVSVNAQLPQFPAQLPFPFLFQLIPVLPDITKCFSSVMDIPGCIAEISQSIFTRKFGNLGPACCE 80 
145334647   1 MSIKNVFSLLAVLCIIVSVNAQLPQFPAQLPFPFPFQLIPGLPDITKCFSSVMDIPECIAEISQSIFTGKFGNLSPACCK 80 
145332735  81 AFLDAKvNCIPKIPFIplfPPMLKEQCSRVAGATPPIPK 119
145334591  81 AFLDAD-NCIPKIPFI---PPMLKEQCSRVAGATPPIPK 115
145334593  81 AFLDAD-NCIPKISFIsffPPMLKEQCSRVAGATPPIPK 118
145334595  81 AFLDAD-NCIPKIPFI---PPMLKEQCSRVAGATPPIPK 115
145334601  81 AFLDAD-NCIPKIPFIpffPPMLKEQCSRVAGATPPIPK 118
145334631  81 AFLDAD-NCIPKIPFIpffPPMLKEQCSRVAGTTPPIPK 118
145334637  81 AFLDTD-NCIPKIPFIpffPPMLKEQCSRVAGATPPIPK 118
145334641  81 AFLDAD-NCIPKIPFIpffPPMLKEQCSRVAGATPPIPK 118
145334643  81 AFVDAD-NCIPKIPLIpffPSMLKEQCSRVAGATPPIPK 118
145334647  81 AFLDAD-NCIPKIPFIpffPPMLKEQCSRVAGATPPIPK 118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap