Conserved Protein Domain Family
PLN00210

?
PLN00210: PLN00210 
40S ribosomal protein S16; Provisional
Statistics
?
PSSM-Id: 177799
View PSSM: PLN00210
Aligned: 34 rows
Threshold Bit Score: 212.276
Threshold Setting Gi: 225457923
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
162605934   1 MRNTIQVYGKKKNSTAIALVKgPGKGIIKVNGIPIDLLQPETLKIKVFEPFFILRSDTFTDIDIRIKVKGGGHVSQLYAI 80 
219109953   3 EVQSVQVFGKKKTATAVAFAK-QGRGLIKVNGQPIELIQPESLRLKVFEPVLIVGQEKFSNIDIRIRVKGGGITAQIYAI 81 
159470701   2 ATQSVQTFGRKKTAVAVAYCK-QGSGLIKLNGQPLELVKPEALRFKVFEPILVIGRAKVKNLDIRLRVKGGGHVSQIYAL 80 
161899291   1 --MIIQCFGKKKNAIAITTAK-KGSGKIKINGVPINLVHPLDIKNKILEPFFILGSNERLNLNFDIFSKGGGKVSQIYAI 77 
145346723   1 --MSVQTFGRKKTAVAVAHTK-RGKGLIRLNGVPIDLVQPDTLRLKAVEPILLLGKERFANVDIRIRVKGGGHVSQMYAV 77 
242069825   8 TPGTVQCFGRKKTAVAVAYTK-PGRGLIKVNGVPIELIRPEMLRLKAFEPILLAGRSRFKDIDMRIRVRGGGKTSQIYAI 86 
242082658   9 AAGTVQCFGRKKTAVAVAYTK-PGRGLIKVNGVPIELIRPEMLRLKAFEPILLAGRSRFKDIDMRIRVRGGGKTSQIYAI 87 
255074629   2 ATQSVQTFGRKKTAVAVVHCK-AGKGLIRFNGAPIELIQPETLKFKAMEPIILLGRQRFANLDLRIRVKGGGHVSQMYAV 80 
160331203   1 MKNIVQVFGRKKTSIAVAVVKgPGNGFIRINGTSIDLIEPEILKYKVFEPLLLMGEAGFGDIDIRIRVKGGGYVSQIYAI 80 
302835219   2 ATQSVQTFGRKKTAVAVAYCK-QGNGLIKLNGQPLELVKPEALRFKVFEPILVIGRQKVKNLDIRLRVKGGGHVSQIYAL 80 
162605934  81 RQAIARGIIRYAEKYVGEETKIKFKNLLLNYDRSLLVKDSRNVEPKKYGGKGARARYQKSYR 142
219109953  82 RAAIAKSIVAYHAKYVDEQSKNELRKTLMEYDRNMLVSDPRRCEPKKYGGRSARARFQKSYR 143
159470701  81 RQAIAKAVVAFYQKYVDEQSKQQIKDALLQFDRTLLVADPRRCEPKKFGGRGARARFQKSYR 142
161899291  78 RQSISKCLVFYYYKYISASKSNLLKIKYLTYDKKLLISDVSRIEPKKYGGLGARARFQKSYR 139
145346723  78 RQAIAKSLVAYYQKYVDEASKKEIKDLLLAYDRTLLVADPRRMEPKKAGGRGARARFQKSYR 139
242069825  87 RQAVAKGLVAYYQKYVDEAAKKEVKDIFSRYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 148
242082658  88 RQAVAKGLVAYYQKYVDEAAKKEVKDIFARYDRTLLVADPRRCEPKKFGGRGARARFQKSYR 149
255074629  81 RQAIAKAIVAYYQKYVDEQSKKELKDALLTYDRTLLVADPRRMEPKKFGGRGARARFQKSYR 142
160331203  81 RQAIARGIVKYFEKFVNETKREEIRNIFLNYDRSILVGDSRRNEPKKSGGKGARSKYQKSYR 142
302835219  81 RQAIAKAVVAFYQKYVDEQSKQQIKDALLQFDRTLLVADPRRCEPKKFGGRGARARFQKSYR 142
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap