Conserved Protein Domain Family
PLN00209

?
PLN00209: PLN00209 
ribosomal protein S27; Provisional
Statistics
?
PSSM-Id: 165774
View PSSM: PLN00209
Aligned: 33 rows
Threshold Bit Score: 131.854
Threshold Setting Gi: 162606434
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
145354555  19 QVLAQDIDLLNPPAALEAGKHKLKRLVQSPNSFFMDVKCQGCFNITTIFSHSQSVVLCGSCSAVLCQPTGGKARLTEGCE 98 
162606434   1 -MRFDSFNLLN--EELEKMKHKKKRIIPNPNSYFINIICKNCKNKNIIFSHSQTKIVCKNCALNLCYPTGGKARLIKGCK 77 
159473513   1 MPLQQDIDLLNPPRELEKRMHKRKRLVQCPNSFFMDVKCQGCFTIQTVFSHSQSVIACGSCGAVLAQPSGGKCRLVPGTS 80 
159477515   1 MVLSSDIDLLNPPAELEKTKHKRKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGSCSSVLCTPTGGRARLTEGCS 80 
219114298   1 ----MPVDLLHPSPEQELHTHKLKRLVQTPNSYFMDIKCPGCFQITTVFSHAQTVVLCSGCNVHLCEPTGGKARLTEGCS 76 
168044283   1 MVLSNDIDLLQPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFSITTVFSHSQTVVLCSSCSTVLCQPTGGRARLTEGCS 80 
224009634   1 ----MPVDLLHPTAEQEARTHKLKRLVASPNSFFMDIKCPGCFQITTVFSHAQTVVLCGSCNVMLCQPTGGRARLTEGCS 76 
255078296   1 MVLAQDIDLLHPPAALEARRHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVLCGSCSAVLCQPTGGKARLTEGCS 80 
303283092   1 MVLAQDIDLLHPPAALEARKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVLCGSCSAVLCQPTGGRARLTEGCS 80 
302843958   1 MVLHSDIDLLNPPADLEKQKHKRKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGSCSSVLCTPTGGRARLTEGCS 80 
145354555  99 WRRKGD 104
162606434  78 FSRF-- 81 
159473513  81 FRRKGE 86 
159477515  81 FRRKSD 86 
219114298  77 YRKKGD 82 
168044283  81 FRKKGD 86 
224009634  77 YRKKVD 82 
255078296  81 FRRKGD 86 
303283092  81 FRRKGD 86 
302843958  81 FRKKSD 86 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap