Conserved Protein Domain Family
PLN00208

?
PLN00208: PLN00208 
translation initiation factor (eIF); Provisional
Statistics
?
PSSM-Id: 177798
View PSSM: PLN00208
Aligned: 31 rows
Threshold Bit Score: 143.784
Threshold Setting Gi: 161899203
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30692796    1 MPK--NKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCDVMCIDGVKRLCHIRGKMHKKVWIAAGDIIL 78 
219110837   1 -------GKGGKNRRRGKGDGEESKRELEFKEDGQEYAQVVKMLGNGRCECFCFDGVTRLGHIRGKMRKKVWITAGDIVL 73 
162606396   1 -MK--SKPKGRNNKKKLIALHNKEKKELIFKDNCQEYGQVIKMLGNGRCDTYCFDGIRRLCHIRGKMRKKVWINTGDIVL 77 
159483465   1 MPK--NKGKGGKNRKRGKNENEEEKRELVYKEDGQEYAQVIRMLGNGRLEAQCIDGKKRLCNIRGKMRKKVWVAQGDIVL 78 
145353610   1 MPKsnSKGKGGKNRRRGKGGGEDEKRELIFKEDGQEYAQVLRMLGNGRLEAQCIDGVKRLCHIRGKMRKKVWVNTGDIIL 80 
145357293   1 MPKsnSKGKGGKNRRRGKGGGEDEKRELIFKEDGQEYAQVLRMLGNGRLEAQCIDGVKRLCHIRGKMRKKVWVNTGDIIL 80 
224062089   1 MPK--NKGKGGKNRKRGKNEAVVGKRELIFKEEGQEYAQVLRMLGNGRCDAMCFDGTKRLCHIRGKMHRKVWIDAGDIIL 78 
224004406   1 MPK--PKGQGGKNRRRGKGDGEESKRELEFKEEGQEYAQVVRMLGNGRCECFCYDGVTRLGHIRGKMRKKVWITAGDIVL 78 
255078580   1 MPKg-VKGKGGKNRRRGKNEG-DEKRELIFKEDGQEYAQVLRMLGNGRLEAQCIDGVKRLCHIRGKMRKKVWVNTGDIVL 78 
302842042   1 MPK--NKGKGGKNRKRGKNENEEEKRELVYKEDGQEYAQVIRMLGNGRLEAQCIDGRKRLCNIRGKMRKKVWVAQGDIVL 78 
30692796   79 VGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGIVGDlDDDDDVVGEDYIEFEDEDIDRI 145
219110837  74 VAKRDFQDEKVDIVHKYSADEARNLKQYGELPETARINETAVDMaMAGDENDDDIGIDFDDI----- 135
162606396  78 VALRDFQNNKGDIIHKYSPDESRKLRAFGELPLTFLSDDKTILE-KKIFSEFMDQKFEFESNSAEIE 143
159483465  79 VGLRDYQDEKADVIMKYTADEARVLKQYGELPEHIRIND--TDViFEGEDKENQEYFDF--DDIAEI 141
145353610  81 LGLRDFQDEKADVILKYLADEARSLKAYGELPDTFRVND---TDtFEEERDENDDFFDF--DDINDI 142
145357293  81 LGLRDFQDEKADVILKYLADEARSLKAYGELPDTFRVND---TDtFEEERDENDDFFDF--DDINDI 142
224062089  79 VGLRDYQDHKADIILKYRTYEARLLKAYGELPANTRINVGIAGGfDEEDDGD-DDYFEFMNAGTSSA 144
224004406  79 VGKRDFQDEKVDILHKYSADEARNLKQYGELPETARINETAVDQaMAGEGDDDDIGIDFDDI----- 140
255078580  79 LGLRDYQDEKADVILKYLADEARSLKAYGELPESIRVNE---TDtFEEERDENDDFFDF--DDVDAI 140
302842042  79 VGLRDYQDEKADVIMKYTADEARVLKQYGELPEHIRIND--TDViFEGEDKENQEYFDF--DDIAEI 141
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap