Conserved Protein Domain Family
PLN00205

?
PLN00205: PLN00205 
ribisomal protein L13 family protein; Provisional
Statistics
?
PSSM-Id: 177795
View PSSM: PLN00205
Aligned: 12 rows
Threshold Bit Score: 296.378
Threshold Setting Gi: 302774801
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302774801   1 QKLRAGLIPQVTEGRRWLLIDAKKEVLGRLASKLAIVLMGKDKPTYSPNKDEGDICVVINAKHITYTGGwKLKNKVYYWH 80 
30678423   16 KKAVAGIKRINLDGLRWRVFDARGQVLGRLASQISTVLQAKDKPTYCPNRDDGDICIVLNAKEIGFTGR-KLTDKFYRWH 94 
30678425   16 KKAVAGIKRINLDGLRWRVFDARGQVLGRLASQISTVLQAKDKPTYCPNRDDGDICIVLNAKEIGFTGR-KLTDKFYRWH 94 
115462819   1 MKALAGLRRINLDGLRWRVFDAKGQVLGRLASQIAVVLQGKDKPTYAPHVENGDMCVVLNAKDISVTGR-KMTDKIYYWH 79 
225452155  11 KKALAGLRRINLEGLRWRVFDAKGQVLGRLASQISTVIQGKDKPTYTPNREDGDMCIVLNAKDISVTGR-KLTNKFYRWH 89 
242055275  13 KKALAGLRRINLDGLRWRVFDAKGQVLGRLASQISVVLQGKDKPTYAPHVENGDMCIVLNAKDISVTGR-KMTDKIYYWH 91 
224060221  15 KKAHAGLKRINLEGLRWRVFDAKGQVLGRLASQISTVIQGKDKPTYAPYRDDGDMCVVLNAKDVCVTGR-KMTDKFYRWH 93 
224141259  15 KKALAGLKRINLEGLRWRVFDAKGQVLGRLASQISTVIQGKDKPTYAPYRDDGDICVVLNAKDVCVTGR-KMTDKFYRWH 93 
255536973  12 KKALAGLRRINLEGLRWRVFDAKGQVLGRLASQISTVIQGKDKPTYAPYREDGDMCIVINAKDVSVTGR-KMTDKFYRWH 90 
255542936  12 KKALAGLRRISLEGLRWRVFDAKGQVLGRLASQISTVIQGKDKPIYAPYREDGDMCIVINTKDVSVTGR-KMTDKFYRWH 90 
302772260   1 QKLRAGLIPQVTEGRRWLLIDAKKEVLGRLASKLAIVLMGKDKPTYSPNKDEGDICVVINAKHITYTGGwKLKNKVYYWH 80 
297828568  16 KKAVAGIKRINLDGLRWRVFDARGQVLGRLASQISTVLQAKDKPTYCPNRDDGDICIVLNAKEIGFTGR-KLTDKFYRWH 94 
302774801  81 TGYIGHLKQIKLNHMIERDPTLPLRKAVFRMMPRNRLHRRRMLKLRVFADERHPFDDKPLVPWTMPPRNIRKPRIYVPRS 160
30678423   95 TGYIGHLKERSLKDQMAKDPTEVIRKAVWRMLPSNNLRDDRDRKLRIFEGGEHPFGDKPLEPFVMPPRRVREMRPRARRA 174
30678425   95 TGYIGHLKERSLKDQMAKDPTEVIRKAVWRMLPSNNLRDDRDRKLRIFEGGEHPFGDKPLEPFVMPPRRVREMRPRARRA 174
115462819  80 TGYIGHLKERRLKDQMEKDPTEAIRKAVMRMLPRNRLRDDRDRKLRIFSGNEHPFHDRPLEPFMMPRRQVREMRPRARRA 159
225452155  90 TGYIGHLKERSLKDQLAKDPTEVIRKAVLRMLPRNKLRDDRDRKLRIFAGDEHPFNDRPLEPYVMPPRQVREMRPRARRA 169
242055275  92 TGYVGHLKERRLKDQMEKDPTEVIRKAVLRMLPRNRLRDDRDRKLRIFSGNEHPFHDRALEPFVMPPRQVREMRPRARRA 171
224060221  94 TGYIGHLKERSLKDQMAKDPTEVIRKAVLRMLPRNKLRDDRDRKLRIFPDSEHPFGDQPVEAYVMPPRKVREMRPRAQRA 173
224141259  94 TGYIGHLKERSLKDQMAKDPTEVIRKAVLRMLPRNKLRDDRDRKLRIFPDSEHPFGDRPLEPYVMPPRQVREMRPRARRA 173
255536973  91 TGYVGNLKERSLKDQLAKDPTEVIRKAVLRMLPRNKLRDDRDRKLRIFAGSEHPFGDRPLESYIMPPRTVREMRPRARRA 170
255542936  91 TGYVGNLKERSLKDQLAKDPTEVIRKAVLRMLPRNKLRDDRDRKLRIFAGSEHPFGDRPLEPYIMPPRTVREIRPRARRA 170
302772260  81 TGYIGHLKQIKLNHMIERDPTLPLRKAVFRMMPRNRLHRRRMLKLRVFADERHPFDDKPLVPWTMPPRNIRKPRIYVPRS 160
297828568  95 TGYIGHLKERSLKDQMAKDPTEVIRKAVWRMLPSNNLRNDRDRKLRIFEGGEHPFGDKPLEPFVMPPRRVREMRPRARRA 174
302774801 161 IKLARRKLAEREaaaaaaaaAAAESEGDGGTAKEgVDRPQ 200
30678423  175 MIRAQKKAEQAE--------NEGTEVKKGKKRTL-SEVPA 205
30678425  175 MIRAQKKAEQAE--------NEGTEVKKGKKRTL-SEVPA 205
115462819 160 LLRAQKKEQDRA--------AAASTKDEENAKNAkSEITA 191
225452155 170 TIRAQKKAEQQQ--------QGTTDTRKKRKKEVePEVSV 201
242055275 172 MLRAQKK----E--------QANRAKEEEDAKNAtAEVTA 199
224060221 174 MIRAQKKAEQLE--------QAGNDKRKGKKREVeADLTE 205
224141259 174 MIRAQKKAEQQE--------QGGNDKRKGKKREVeAELTE 205
255536973 171 MIRAQKKAEQQR--------QGANEMQKGRKKEVeVEITH 202
255542936 171 MIRAQRKAEQQV--------RGANEMRKGRKKEVeAEVAQ 202
302772260 161 IKLARRKLAEREaaa---aaAAAESEGDGGTAQEgVDRPQ 197
297828568 175 MIRAQKKAEQAE--------NEGTEVKKGKKRTP-SQVTA 205
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap