Conserved Protein Domain Family
PLN00202

?
PLN00202: PLN00202 
beta-ureidopropionase
Statistics
?
PSSM-Id: 177792
View PSSM: PLN00202
Aligned: 12 rows
Threshold Bit Score: 800.979
Threshold Setting Gi: 302761028
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
168030450   1 MENEPASATKDGSLH--------GYESLHRLLSSELPPHLFQEVSRVLYGCNRGSAVTPVPQTEDLSAAAKEGNFDVQTF 72 
30698009    4 MISENGETSAEGSIC--------GYDSLHQLLSANLKPELYQEVNRLLLGRNCGRSLEQIVLPESAKALSSKHDFDLQAA 75 
115472115  10 PQGEDAPAAAAGSIG--------GYESLHRLLQSNLSPELFKEASRLLLGLNCGRALEAISLPEATSALAKAHNFDVQAF 81 
159463476   1 --------MAEGSLA--------GFASLEELLEEYVPADKLKQAKRVIYGLNLGEPVGELQLDAGVLERAKAMGFDLRSA 64 
225465781   9 GKLEETQPSTDGSIC--------GFQSLHHLLKASLQPHLYQEVSRLLLGLNCGKPLENIALPESAKALSLEHGFDLQAY 80 
242050246  10 QGEEGKTPPPAGSIG--------GYESLHRLLEANLSPELFQEASRLLLGLNCAQPLEAISLPDATTTLAETHNFDVQAF 81 
224095800  13 GNLEESSSEKDGSIC--------GYESLHHLLSVNLKPHLYKEVSRLLIGLNCGKPLELIALPESAKALSSKHDFDLQAF 84 
255584039  11 NNSIEDKTSKDGSIC--------GYESLHHLLRANLKPHLFKEVSRLLQGVNCGRAVESIALPESAKSLSSEHEFDLQAF 82 
302761028   1 ----------------------------------------------MILGLNNGSVVGMLPLPPAVMAMSTAADFDLQAY 34 
302769127  25 CDVEDLERVGGGVVAlgdvpqdgGSDSLYRLLKHHLPPGVFKEASRMILGLNNGSVVGMLPLPPAVMAMSTAADFDLQAY 104
297794023   4 IISENGDTAAEGSIC--------GYDSLHQLLSANLKPELYQEVNRLLLGRNCGRSLEQIVLPESAISLSSKHDFDLQAV 75 
302849822   1 --------MADGSLA--------GFATLEELMEEYIPPEKLQQARRVLYGVNMGQLVTGMALDLALCERAKLMDFDLRSA 64 
168030450  73 EFTADLEQMRAPRNVCVGLIQNAIVLPTTEPFLKQKHAIMERVTSLIESAAKAGVNILCLQEAWTMPFGFCTREKRWCEF 152
30698009   76 SFSADKEQMRNPRVVRVGLIQNSIALPTTAPFSDQTRGIFDKLKPIIDAAGVAGVNILCLQEAWTMPFAFCTRERRWCEF 155
115472115  82 RFDADKEYLRQPRVIRVGLIQNSIAIPTTSHFADQKKAIMEKVKPMIDAAGDAGVNILCLQEAWTMPFAFCTREKRWCEF 161
159463476  65 LFRAAPEQMRPPRIVRIGLIQNKIVLPTTAPFAAQAQAIRDRVEVMLDTAGRAGVKVVCLQEAWHMPFAFCTREKVWCEF 144
225465781  81 CFHADKEQLRESRIVRVGLIQNSIASPTTAPFLDQRGAIFEKLKPIIDAAGASGVHILCLQEAWTMPFAFCTREKRWSEF 160
242050246  82 RFSADKEFLRQPRVVRVGLVQNSIAVPTTCHFADQKKAIMDKIKPVIDAAGASGVNILCLQEAWTMPFAFCTREKRWCEF 161
224095800  85 SFDADKELVREPRVVRVGLIQNSVALPTTAPLLDQKRAIFQKLKPIIDSAGASGVNILCLQEAWMMPFAFCTREKRWCEF 164
255584039  83 HFDADKELTREPRVVRVGLIQNSIALPTTAPLLDQKRAIFQKVKPIIDAAGSSGVNILCLQEAWMMPFAFCTREKSWCEF 162
302761028  35 RFTAAEEELRAPRIVRIGVIQNAIVLPTDAPFADQKRAIMKRVGDLIEAAGTAGVNILCLQEAWTMPFAFCTREKTWCEF 114
302769127 105 RFTAAEEELRAPRIVRIGVIQNAIVLPTDAPFADQKRAIMKRVGDLIEAAGTAGVNILCLQEAWTMPFAFCTREKTWCEF 184
297794023  76 SFSADKEQMRNPRVVRVGLIQNSIALPTTAPFSDQTRGIFDKLKPMIDAAGVAGVNILCLQEAWTMPFAFCTRERRWCEF 155
302849822  65 VFRAAPEQLRPARIVRIGLIQNKIVLSTDAPFAEQAQAIRDRVGQMLETAGQAGVKVVCLQEAWHMPFAFCTREKRYCEF 144
168030450 153 AESAEaGESTKLLQGLAQRYNMVIVSPILERDESHGSTIWNTAVVIGNHGNVIGKHRKNHIPRVGDFNESTYYMEGNTGH 232
30698009  156 AEPVD-GESTKFLQELAKKYNMVIVSPILERDIDHGEVLWNTAVIIGNNGNIIGKHRKNHIPRVGDFNESTYYMEGDTGH 234
115472115 162 AEPVD-GESTQFLQQLAKKYNMVIVSPILERDVNHGEIVWNTAVVIGNHGNIIGIHRKNHIPRVGDFNESTYYMEGNTGH 240
159463476 145 AESAEtGESVAFCQAAARRWGMVVVCPILERDAAHNDTVWNTAVVIGHNGNIIGKHRKNHIPRVGDFNESTYYMEGNTGH 224
225465781 161 AEPVD-GESTQFLQDLAQKYNMVIVSPILERDVKHGETIWNTAVIIGNNGNIIGKHRKNHIPRVGDFNESTYYMEGNTGH 239
242050246 162 AEPVD-GESTQFLQELAQKYNMVIVSPILERDVNHGETIWNTAVIIGNNGNIIGIHRKNHIPRVGDFNESTYYMEGNTGH 240
224095800 165 AEPVD-GESTQFLQEYARKYNMVIINPILERDVNHGETLWNTAIIIGNRGNIIGKHRKNHIPRVGDFNESTYYMEGNTGH 243
255584039 163 AEPVD-GESTQFLLEYARKYNMVIISPILERDVNHGETLWNTAVVIGNHGNIIGKHRKNHIPRVGDFNESTYYMEGNTGH 241
302761028 115 AESAEeGTSTKFLQMFACKFKMVIISPILERDEVHGGTLWNTAVVIGNNGNVIGKHRKNHIPRVGDFNESTYYMEGNTGH 194
302769127 185 AESAEeGTSTKFLQMFACKFKMVIISPILERDEVHGGTLWNTAVVIGNNGNVIGKHRKNHIPRVGDFNESTYYMEGNTGH 264
297794023 156 AEPVD-GESTKFLQELAKKYNMVIVSPILERDIDHGEVLWNTAVIIGNNGNIIGKHRKNHIPRVGDFNESTYYMEGDTGH 234
302849822 145 AESAEtGESVAFCQAAARRWGMVVICPILERDAAHSDTIWNTAVVIGHNGNIIGKHRKNHIPRVGDFNESTYYMEGNTGH 224
168030450 233 PVFETEFGKIAVNICYGRHHPMNWQAFGMNGAEIVFNPSATVGDLSEPMWPIEARNAAIANSYFVGAINRVGTEVFPNEF 312
30698009  235 PVFETVFGKIAVNICYGRHHPLNWLAFGLNGAEIVFNPSATVGELSEPMWPIEARNAAIANSYFVGSINRVGTEVFPNPF 314
115472115 241 PVFETAYGKIGVNICYGRHHPLNWLAFGLNGAEIVFNPSATVGELSEPMWPIEARNAAIANSYFVGSINRVGTEVFPNPF 320
159463476 225 PVFETAFGKIAVNICYGRHHPMNWQAFGMNGAELVFNPAATVGDLSEPLWPVEARNAAIANSYFVAGINRVGTESFPREF 304
225465781 240 PVFETAFGKIAINICYGRHHPLNWLAFGLNGAEIVFNPSATVGELSEPMWPIEARNAAIANSYFVASINRVGTEIFPNPF 319
242050246 241 PVFETAYGKIGVNICYGRHHPLNWLAFGLNGAEIVFNPSATVGELSEPMWPIEARNAAIANSYFVGSINRVGTEVFPNPF 320
224095800 244 PVFETAYGKIAVNICYGRHHPLNWLAFGLNGAEIVFNPSATVGELSEPMWPIEARNAAIANSYFVGSINRVGTETFPNPF 323
255584039 242 PVFETAYGKIAVNICYGRHHPLNWLAFGLNGAEIVFNPSATVGELSEPMWPIEARNAAIANSYFVGSINRVGTEIFPNPF 321
302761028 195 PVFETAYGKIAVNICYGRHHTLNWQAFGMNGAEIVFNPSATVGDLSEPMWPIEARNAAIANSYFVAAINRVGTEVFPRAF 274
302769127 265 PVFETAYGKIAVNICYGRHHTLNWQAFGMNGAEIVFNPSATVGDLSEPMWPIEARNAAIANSYFVAAINRVGTEVFPRAF 344
297794023 235 PVFETVFGKIAVNICYGRHHPLNWLAFGLNGAEIVFNPSATVGGLSEPMWPIEARNAAIANSYFVGSINRVGTEVFPNPF 314
302849822 225 PVFETAFGRIAVNICYGRHHPMNWQAFGMNGAELVFNPAATVGDLSEPLWPVEARNAAIANSYFVAAINRVGTEVFPNEF 304
168030450 313 TSGDGKPAHKDFGHFYGSSFVAAPDASCSPSLSRCRDGLLVAKLDLNLCQQLKDKWGFRMTSRIDMYADFFREYVQHDFK 392
30698009  315 TSGDGKPQHNDFGHFYGSSHFSAPDASCTPSLSRYKDGLLISDMDLNLCRQYKDKWGFRMTARYEVYADLLAKYIKPDFK 394
115472115 321 TSGDGKPQHADFGHFYGSSHFSAPDASCTPSLSRYRDGLMISDMDLNLCRQIKDKWGFRMTARYDTYASLLSEYLKPDFK 400
159463476 305 TSGDGKPAHKDFGHFYGSSYVAAPDGSRGPSLARHRDGLMVADVDLNLCRQTKDKWGFQMTARYDMYADFFAKFVKPDFK 384
225465781 320 TSGDGKPQHADFGHFYGSSHFSAPDASCTPSLSRYQDGLLISDMDLNLCRQLKDKWGFRMTSRYEMYAELLARYIKPDFE 399
242050246 321 TSGDGKPQHADFGHFYGSSHFSAPDASCTPSLSRYRDGLIISDMDLNLCRQIKDKWAFRMTARYEMYASLLSEYLKPDFK 400
224095800 324 TSGDGKPQHADFGHFYGSSHFSAPDASCTPSLSRYKDGLLISDMDLNLCRQLKDKWGFRMTARYELYADMLARYLKPDFE 403
255584039 322 TSGDGKPQHTDFGHFYGSSHFSAPDASCTPSLSRYKDGLLISDMDLNLCRQIKDKWGFRMTARYELYADTFDRYLKPDFE 401
302761028 275 TSGDGKPAHKGFGHFYGSSYVAAPDSSCTPSLSRLQDGLMVVDADLNLCQQVRDKWGFRMTARYDLYANFFNEYTKHAFK 354
302769127 345 TSGDGKPAHKGFGHFYGSSYVAAPDSSCTPSLSRLQDGLMVVDADLNLCQQVRDKWGLRMTARYDLYANFFNEYTKHAFK 424
297794023 315 TSGDGKPQHNDFGHFYGSSHFSAPDASCTPSLSRYKDGLLISDMDLNLCRQYKDKWGFRMTARYEVYADLLAKYIKPDFK 394
302849822 305 TSGDGKPAHKEFGPFYGSSYVAAPDGSRSASLARHKDGLLVADIDLNLCRQTKDKWGFQMTARYEMYAEFFNRFVQPDFK 384
168030450 393 PQVIHDSYLDglpamnSRTT 412
30698009  395 PQVVSDPLLH------KNST 408
115472115 401 PQVIVDPLIN------KSA- 413
159463476 385 PQVIRDPAL----------- 393
225465781 400 PQVVSDPSLH------KKSS 413
242050246 401 PQVIVDPLIN------KKA- 413
224095800 404 PQVISDPLLH------KKSL 417
255584039 402 PQVVSDPLLH------KRSL 415
302761028 355 PQVISDPLLHsg--leAHSL 372
302769127 425 PQVISDPLLHsg--leAHSL 442
297794023 395 PQVVSDPLLH------KNSS 408
302849822 385 PQIVRDPSL----------- 393
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap