Conserved Protein Domain Family
PLN00200

?
PLN00200: PLN00200 
argininosuccinate synthase; Provisional
Statistics
?
PSSM-Id: 177791
View PSSM: PLN00200
Aligned: 19 rows
Threshold Bit Score: 725.768
Threshold Setting Gi: 224011487
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219120979   1 MTDAKPKLLLAYSGGLDTSVILKWLSEK-GFDVIAFCANVGQHEEDFSAVKAKAESCGATKCVISDLRKEFVDDYVLEAI 79 
224097614  68 LRGKLNKVVLAYSGGLDTSVIVPWLRENyGCEVVCFTADVGQGVGELEGLEQKAKASGACQLVVKDLQEEFVRDFIFPCL 147
225456274  95 LRGKLNKVVLAYSGGLDTSVIVPWLRQNyGCEVVCFTADVGQGIKELEGLEEKAKASGACQLVVKDLKEEFVKDYIFPCL 174
255560303  90 LRGKLNKVVLAYSGGLDTSVIVPWLRENyGCEVVCFTADVGQGLKELEGLEEKAKASGACQLVVKDLQEEFVRDYIFPCL 169
255575811  88 LRGQLNKVVLAYSGGLDTSVIVPWLRENyGCEVVCFTADVGQGLKELEGLEEKAKASGACQLVVKDLQEEFVRDYIFPCL 167
159477301  36 KMGQVKKVVLAYSGGLDTSIILKWLQDTyGCEVVTFTADLGQG-EELEPARAKAEKMGVKQIFIDDLREEFVRDYVFPMF 114
145354797   1 ---MSSAVVLAYSGGLDTSIILKWLQDTyGCEVVTFTADLGQG-EELEPARAKAAQFGVKEIFVDDLREEFVRDYVFPMF 76 
224110162   6 LRGKLNKVVLAYSGGLDTSVIVPWLRENyGCEVVCFTADVGQGVGELEGLEQKAKASGACQLVVKDLQEEFVRDFIFPCL 85 
255088800  54 PSGEVKKVVLAYSGGLDTSIILKWLQDTyGCEVITFTADLGQG-EELEPARAKAEQMGVKQIYIDDLREEFVRDYVFPMF 132
303288041   1 ----MAWVVLAYSGGLDTSIILKWLQDTyGCEVVTFTADLGQG-EELEPARAKAEQMGVKEIYIDDLREEFVRDYVFPMF 75 
219120979  80 KCNAIYEGRYLLGTSIARPCIAKEMIRIAHEEGATFIAHGATGKGNDQ------------------VRFEMCCQALSPTI 141
224097614 148 RAGAIYERKYLLGTSMARPVIAKAMVDVAKEVGADAVAHGCTGKGNDQ------------------VRFELTFFALNPEL 209
225456274 175 RAGAIYERKYLLGTSMARPVIAKAMVDVAKEVGADAVSHGCTGKGNDQ------------------VRFELTFFALNPEL 236
255560303 170 RAGAIYERKYLLGTSMARPVIAKAMVDVAKEVGADAVAHGCTGKGNDQ------------------VRFELTFFALNPEL 231
255575811 168 RAGAIYERKYLLGTSMARPVIAKAMVDVAKEVGADAVAHGCTGKGNDQ------------------VRFELTFFALNPEL 229
159477301 115 RANALYEGTYLLGTSIARPLIAKRQIEIAKEVGADAVSHGATGKGNDQ------------------VRFEVGYYSLKPDI 176
145354797  77 RANALYEGTYLLGTSIARPLIAKRQIEIAKQVGADAVCHGATGKGNDQ------------------VRFELGYYGLKPDV 138
224110162  86 RAGAIYERKYLLGTSMARPVIAKAMVDVAKEVGADAVAHGCTGKGNDQacltnrsnltntrafpssVRFELTFFALNPEL 165
255088800 133 RANAIYEGTYLLGTSIARPLISKRQIEIAKEVGADAVCHGATGKGNDQ------------------VRFELGYYGLKPDI 194
303288041  76 RANAVYEGEYLLGTSIARPLIAKRQIEIAREVGADAVCHGATGKGNDQar---------------sVRFELGYYGLKPDV 140
219120979 142 QCVAPWRDAEfiesFKGRKDLLAYCNQHQIPVDAKPK--ANYSIDENLFHTSYESGMLEDAMCPPDESMFKMTVSPQAAP 219
224097614 210 NVVAPWREWD----ITGREDAIEYAKKHNVPVPVTKK--SIYSRDRNLWHLSHEGDILEDPANEPKEDMYMMSTSPEAAP 283
225456274 237 NVVAPWREWE----IRGREDAIEYAKKHNVPVPVTKK--SIYSRDRNLWHLSHEGDILEDPENEPKNDMYMMSVDPEHAP 310
255560303 232 NVVAPWREWD----IKGREDAIEYAKKHNVPVPVTKK--SIYSRDRNLWHLSHEGDILEDPANEPKKDMYMMSVDPENAP 305
255575811 230 NVVAPWREWD----IKGREDAIEYAKKHNVPVPVTKK--SIYSRDRNLWHLSHEGDILEDPANEPNKDMYMMSVDPEDAP 303
159477301 177 KVIAPWREWD----LLSRTKLIEYAEQNNIPVPASKRgePPFSMDANLLHISYEGNALEDPWTTPDDSMFTRSVSPEKAP 252
145354797 139 KVIAPWREWD----LNSRTKLLAYADEAGIPVAQSKRqdAPYSTDANLLHISYEGNALEDPWVEYSEDMFTRSVSPENAP 214
224110162 166 NVVAPWREWD----ITGREDAIEYAKKHNVPVPVTKK--SIYSRDRNLWHLSHEGDILEDPANEPKEDMYMMSTSPEAAP 239
255088800 195 KVIAPWREWD----LNSRTKLLDYAEKNGIPIAKNKRqeAPYSMDANLLHISYEGLALEDPWVEYTEDMFTRSVAPENAP 270
303288041 141 KVIAPWREWD----LNSRTKLIAYAEEAGIPVAQSKRqeAPYSMDANLLHISYEGNALEDPMVGYTEDIFTRSVAPEDAP 216
219120979 220 DLPETIRIEFDQGLPVKLTNVTdgteiTDSLELFLYCNTIAGKHGIGRIDIVENRFVGIKSRGVYETPGGTLLRAAHMDL 299
224097614 284 DKPEYVEIGIVSGLPVSVNGVK-----LSPASLLSKLNEIGGKHGIGRIDMVENRLVGMKSRGVYETPGGTILFTAVREL 358
225456274 311 DQPEYIEIGMVSGLPVSVNGKE-----LSPASLLSKLNEIGGRHGIGRIDMVENRLVGMKSRGVYETPGGTILFTAAREL 385
255560303 306 NQPEYVEIGIVSGLPVSVNGKQ-----LSPASLLSHLNEIGGRHGIGRIDMVENRLVGMKSRGVYETPGGTILFTAAREL 380
255575811 304 NQPEYIEIGIVSGLPVSVNGKQ-----LSSASLLSQLNEIGGRHGIGRIDMVENRLVGMKSRGVYETPGGTILFTAAREL 378
159477301 253 DQPTTIEIAFEKGNPVAIDGVP-----MSPATILTKLNELGGQNGIGRVDLVESRFVGMKSRGVYETPGGTILQVAHRGM 327
145354797 215 DKPTYIEVEFEKGDPVAIDGVK-----YSPADMLAKLNQLGGDNGIGRLDIVESRFVGMKSRGVYETPGGTILLAVRRAL 289
224110162 240 EKPEYVEIGIVAGLPVSVNGEK-----LSPASLLSCLNEIGGKHGIGRIDMVENRLVGMKSRGVYETPGGTILFTAVREL 314
255088800 271 DTPTYLEIEFEKGDPVAINGER-----MSPAAMLTALNKYGGDNGIGRLDIVESRFVGMKSRGVYETPGGTLLLHARRGI 345
303288041 217 DAPTFLDIDFEGGDPVAINGER-----MSPATMLTALNKYGGDNGIGRLDIVESRFVGMKSRGVYETPGGTILLRARRGV 291
219120979 300 EGITMDREVKRIAEHLSAEFARLCYNGFWFAPEMDLVRYSLDFTQRDVVGVVELELYKGNVTIRGRQSPKALYNADLASM 379
224097614 359 ESLTLDRETMQVKDSLALKYAELVYAGRWFDPLRESMDAFMEKITEKTNGSVRLKLYKGSVSVASRTSPNSLYREDISSF 438
225456274 386 ESLTLDRESIQQKDSLALKYAELVYAGRWFDPIRESIDAFMKKITETTTGSVRLKLYKGSVTVAGLKSPYSLYRQDISSF 465
255560303 381 ESLTLDRETMQVKDSLALKYAELVYAGRWFDPLRESMDAFMEKISEKTTGSVTLKLYKGSVSVTSRTSPYSLYRQDISSF 460
255575811 379 ESLTLDRETMQVKDSLALKYAELVYAGRWFDPLRESMDAFMEKISEKTTGSVTLKLYKGSVLVTSRTSPYSLYRQDISSF 458
159477301 328 ESICLDREELHMKDDLMPRYAQLVYNGFWFSPEREALQALVDKTQEYCTGVVKVKLYKGNVQVQGRKSPYSLYDKVIASF 407
145354797 290 ETICLDRGEMHYKDQMMPQYAELIYNGFWFSPEREMMQAAIDTCSESVTGTVRAKLYKGNVIVVGRKAANTLYDDRLSTF 369
224110162 315 ESLTLDRETMQVKDSLALKYAELVYAGRWFDPLRESMDAFMEKITETTTGSVRLKLYKGSVSVVSRTSPKSLYREDISSF 394
255088800 346 ESICLDRGESHLKDELMPRYAELIYNGFWFSPEREMLQAAIDRCAENVNGTVRVKLYKGNVDVVGRKSAQSLYNANIASF 425
303288041 292 ESVCLDRGEMHLKDELMPRYAELIYNGFWFSPEREMLQAAIDTCAKNVNGTVRVKLFKGNVDVVGRESAQTLYNAKLSTF 371
219120979 380 DIEGggdafDYNPADANGFIRINAVRLKTYAALRAKD 416
224097614 439 ESGQ-----IYDQADAAGFIRLYGLPMRVRAMLEKGI 470
225456274 466 ESGQ-----IYDQADAAGFIRLYGLPMKVRAMLEKGI 497
255560303 461 ESGK-----IYDQADAAGFIRLYGLPMKVRAMLENGI 492
255575811 459 ESGK-----IYDQADAAGFIRLYGLPMKVRAMLENGI 490
159477301 408 EDDKg----LYNQADAGGFIKLQALRLRTLGVNRYKK 440
145354797 370 EEDGg----AYDQKDAAGFIKLQALRLRTLKVAREKK 402
224110162 395 ESGQ-----IYDQADAAGFIRLYGLPMRVRAMLEK-- 424
255088800 426 EDDGg----AYDQKDAAGFIKLNALRLRTLGTQRGVP 458
303288041 372 EEDDg----AYDQKDAAGFIKLQALRLRTLGTQRGPP 404
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap