Conserved Protein Domain Family
PLN00196

?
PLN00196: PLN00196 
alpha-amylase; Provisional
Statistics
?
PSSM-Id: 165762
View PSSM: PLN00196
Aligned: 5 rows
Threshold Bit Score: 801.44
Threshold Setting Gi: 242049154
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242066624   1 MANKCLPFALFIVLLGLSSNlaaGQILF--------QGFNWESWKQNGGWYNFMMGKVDDIAEAGITHVWLPPASHSLAE 72 
115469938   2 ATGRRLSMILLLLLLGLASG---DKILF--------QGFNWESWRQSGGWYNLLMGKVDDIVAAGVTHVWLPPPSHSVST 70 
115448881   8 VNKHFLSLSVLIVLLGLSSNltaGQVLF--------QGFNWESWKENGGWYNFLMGKVDDIAAAGITHVWLPPPSHSVGE 79 
242049154   1 MGNRHLCCLSLLLLLGLAS----GQVLFqnrefvivQAFNWESWKQSGGWYNLLMGKVDDIAAAGVTHVWLPPPSHSVST 76 
242063184   1 MASTSLCMCFFLVFLGLSFNlalGQVLF--------QGFNWESWKQNGGWYKFLMDKVDDIAEAGITHVWLPPPSHSVAE 72 
242066624  73 Q----GYLPGRLYDLDASKYGNEAQLKSLIEAFHDKGVKVIADIVINHRTAEHEDGRGIYCLFEGGTPDSRLDWGPHMIC 148
115469938  71 Q----GYMPGRLYDLDASRYGTSMELKSLISALHGKGIQAIADVVINHRCADYKDSRGIYCIFEGGTPDGRLDWGPHMIC 146
115448881  80 Q----GYMPGRLYDLDASKYGNEAQLKSLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSRLDWGPHMIC 155
242049154  77 QelgaGYMPGRLYDLDASKYGTAAELKSLIAAFHGKGVQVVADIVINHRCADYKD---------GGTPDGRLDWGPHMIC 147
242063184  73 Q----GYLPGRLYDLDASKYGNKAQLKSLIKAFHDKGVKVIADIVINHRTAEHKDGRGIYCLFEGGTSDSRLDWGPHMIC 148
242066624 149 SDDRTYSDGTGNPDTGADFGGAPDIDHLNPRVQRELIGWLNWLKTD-IGFDAWRLDFAKGYSADVAKVYIDNTEP-CFAV 226
115469938 147 RDDTQFSDGTGNLDTGADFAAAPDIDHLNGVVQRELTDWLLWLKSDeVGFDAWRLDFARGYSPEVAKVYIEGTTPvGLAV 226
115448881 156 RDDP-YGDGTGNPDTGADFAAAPDIDHLNKRVQRELIGWLDWLKMD-IGFDAWRLDFAKGYSADMAKIYIDATEP-SFAV 232
242049154 148 RDDTIYSDGTANLDTGADFAAAPDIDHLNDRVQRELTDWLLWLKSD-LGFDAWRFDFAKGYSAEVAKVYVDGTAP-SFAV 225
242063184 149 RDDKAYSDGTGNLDTGLDFPGAPDIDHLNKRVQRELIGWLKWLQTD-IGFDAWRLDFAKGYSAEVAKIFIDNAKP-SFAV 226
242066624 227 AEIWTSLAYGGDGKPFYDQNAHRQELVNWLDRVGGKASPATTFDFTTKGILNVAVDGELWRLRGADGKAPGLIGWWPAKA 306
115469938 227 AELWDSMAYGGDGKPEYNQDAHRQALVDWVDRVGGTASAGMVFDFTTKGIMNTAVEGELWRLIDQQGKAPGVIGWWPAKA 306
115448881 233 AEIWTSMANGGDGKPNYDQNAHRQELVNWVDRVGGANSNATAFDFTTKGILNVAVEGELWRLRGEDGKAPGMIGWWPAKA 312
242049154 226 AEIWNNMAYDGNNKPEYDQDPHRQALVDWVDKVGGAASPATVFDFTTKGILNAAVEGELWRLIDPQGKAPGVIGWWPAKA 305
242063184 227 AELWSSLAYGGDGKPLQDQNAHRQELVNWVDRVGGKASPATTFDFTTKGILNVAVDGELWRLRGADGKAPGMIGWWPAKA 306
242066624 307 VTFVDNHDTGSTQHMWPFPADKVMQGYAYILTHPGNPSIFYDHFFDWGLKNEIAHLVSIRDRHGIQADSELRIIEADADL 386
115469938 307 VTFVDNHDTGSTQQMWPFPSDKVMQGYAYILTHPGNPCIFYDHFFDWGLKEQIAALVAVRQRNGVTATSSLKIMLHDADA 386
115448881 313 TTFVDNHDTGSTQHLWPFPSDKVMQGYAYILTHPGNPCIFYDHFFDWGLKEEIERLVSIRNRQGIHPASELRIMEADSDL 392
242049154 306 VTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGNPCIFYDHFFDWGFKDEIAALVAVRKRNGITPTSELTILEHDGDS 385
242063184 307 VTFVDNHDTGSTQHMWPFPADKVIQGYAYILTHPGNPCIFYDHFFDSGLKNEIAQLVSIRNRHGIQPDSKLRIIKADADL 386
242066624 387 YLAEIDGKVIVKIGSRYDCDHLIPEGFQVVVHGDGYAVWEKN 428
115469938 387 YVAEIDGKVVMKIGSRYDVSSLIPPGFHLAAHGNGYAVWEKI 428
115448881 393 YLAEIDGKVITKIGPRYDVEHLIPEGFQVVAHGDGYAIWEKI 434
242049154 386 YVAEIGGKVIVKIGSRYDVGHLIPAGFEVAAHGNDYAVWEKA 427
242063184 387 YLAEIDDKVIVKIGPRFGASQLIPGGFQVVAHGNGYAVWEKI 428
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap