Conserved Protein Domain Family
PLN00190

?
PLN00190: PLN00190 
60S ribosomal protein L21; Provisional
Statistics
?
PSSM-Id: 177784
View PSSM: PLN00190
Aligned: 33 rows
Threshold Bit Score: 209.581
Threshold Setting Gi: 162606458
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219121266   1 MPHSFGLRARTRHMFAKKHRQHGPIHLSQYLMKVKVGDYVDIFADPAVHKGMPHKGYHGRTGIIFNVTKSAVGVRVNKFV 80 
159479900   1 MPGGQGLRARTRHMFARGFRQKGFIPLTTYLRTYKLGDMVDIKVNGAIHKGMPHKWYQGKTGTVWNVTKRAIGVEVNKRV 80 
145354667   5 RARSRGLRHGTRNLFSRGHREHGTLNTTTYLRTFRVGDYVDIKVNSAQQKGMPYLQYQGKTGIVWNVTPRAVGVEINKTI 84 
168029413   1 MPAGHGLRSRTRDLFSRPFRHKGYIPLTTYLRTFKVGQYVDIKVNGAVHKGMPHKFYHGRTGIVWNVTKRAVGVVMNKQV 80 
168032907   1 MPAGHGLRSRTRDLFSRPFRHKGYIPLTTYLRTFKVGQYVDIKVNGAVHKGMPHKFYHGRTGIVWNVTKRAVGVVMNKQV 80 
168058464   1 MPAGHGLRSRTRDLFSRPFRHKGYIPLTTYLRTFKVGQYVDIKVNGAVHKGMPHKFYHGRTGIVWNVTKRAVGVVMNKQV 80 
224005290   1 MPHSFGVRARTRHMFAKKFRDHGPLHLSQYFLSVKVGDYVDIFANPSIHKGMPHKHYHGRTGIVFNVTKSSVGVRVNKLV 80 
255088866   5 RARSRGLRHGTRNMFSRPFRKKGPNNATTYLRTFRIGDYVDIKVNPSQQKGMPYLAYQGRTGIVWNVTPRAVGVEVNKQI 84 
303288373   5 RARSRGLRHGTRNMFSRPFRKKGTLNSTTHLRIFKVGQYVDIKVNPAQQKGMPYLAYQGRTGIVWNVTPRAVGVELNKQI 84 
302829088   1 MPGGQGLRARTRHMFARGFRQKGFIPLTTYLRTYKLGDFVDIKVNGAIHKGMPHKWYQGKTGVVWNVTKRAIGVEINKRV 80 
219121266  81 NGRIIEKRIHVRIEHVRKSKCQQEILRRKKENEAAKDEARKTGNQVN-LKRTPKLPKDGYMLaapggEGAEITTIQPLPF 159
159479900  81 GHRIMKKRIHVRVEHIVPSRCREEFLTRRASNDAAKAAAKAKGEPVPkTKRVPAGPRDGFEL-----IPAKVETIAAIPY 155
145354667  85 GGRIARKRIHVRVEHVQHSRCREDFIARRAANDKAHHEAKLAGKKIVtKRPVTGAPRTGFAL-----ENVKSELLTPIPY 159
168029413  81 GNRIIQKRLHVRIEHVQPSRCREEFLERRKSNDIKKAEAKAKGETVN-LKRQPAGPRDGFVL-----DSSTLETVTPIPY 154
168032907  81 GNRIIQKRLHVRIEHVQPSRCREEFLERRKSNDIKKAEAKARGETVD-LKRQPAGPRAGFVL-----DSSTLETVTPIPY 154
168058464  81 GNRIIQKRLHVRIEHVQPSRCREEFLERRKSNDLKKAEAKAKGETVN-LKRQPAGPRAGFVL-----DSSTLETVTPIPY 154
224005290  81 NGRILEKRIHVRIEHIRKSKCQKEIIARVKSNELAKAEARKTGVKVD-LKRHPKQPKEGYFLaa-pgGDGEITTIQPLPF 158
255088866  85 GGRVARKRIHVRIEHVQHSNCRADFLARRKANDEAHEAAHKSGQPAPqTKRTVPGPREGFTL-----ENVKTEILTAVPY 159
303288373  85 GGRVARKRIHVRVEHVVHSRCREEFLERRAANDAAHAAAHAKGEKAPeTKRTIPGPRAGFTL-----ENVKTEILTPIPY 159
302829088  81 GHRIIKKRIHVRVEHVQPSRCREEFLARRAANDAAKAAAKAKGEPVPkTKRVPQGPRGGFEL-----IPEKVETIAAIPY 155
219121266 160 SDLV 163
159479900 156 DIIK 159
145354667 160 DILR 163
168029413 155 DVVN 158
168032907 155 DVVN 158
168058464 155 DVVN 158
224005290 159 SDLV 162
255088866 160 DIVR 163
303288373 160 DIVR 163
302829088 156 DIIK 159
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap