Conserved Protein Domain Family
PLN00187

?
PLN00187: PLN00187 
photosystem II light-harvesting complex II protein Lhcb4; Provisional
Statistics
?
PSSM-Id: 177781
View PSSM: PLN00187
Aligned: 20 rows
Threshold Bit Score: 504.324
Threshold Setting Gi: 297823921
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302807871   1 MASALAASSFTGCGVrdlvgyaaasstSQVASRSSGIVARFGL----G-KKKGTKKVTKKSSSSGGANRPLWFPGAKCPD 75 
15225630    3 TTTAAAASGIFGIRI------------QDPRPGTGRVQARFGFs--fG-KKKPAPPPKKSRQVQDDGDRLVWFPGANPPE 67 
168040679   6 RCASIASSSFVRSVE------------RLGVQNGSRVVARFSVpgkaK-QAAKAASKAVKKASGSGAGRPLWFPGAQAPE 72 
168040609   6 RCASIASSSFVRSVE------------RLGVQNGSRVVARFSVpgkaK-QAAKAASKAVKKASGSGAGRPLWFPGAQAPE 72 
168067076   6 RSASIAASSFVGSVE------------CFGVKNGARVVARSSLggkaK-QVAKQASKTLKKSSGAGADRPLWFPGARAPE 72 
242050544   3 SSVAAAASTFLGTRL------------SDPAPQNGRIVARFGF----G-KPKKAAAPK--KVSKISSDRPLWFPGAVAPD 63 
224101127   3 ATTAVAASYFSGTRT------------QYTKQNPGKIQALFGF----GtKKSPPPPPPKKSSPKQFEDRLVWFPGASPPE 66 
255571917   6 TAAATAASHFFRTRT------------QNPKPKVGKIQARFGFggfgGfGTKKSSPPPKKTAPKPVEDRLVWFPGANPPE 73 
302784975   1 MASALAASSFTGCGVrdlvgyaaasstSQVASRSSGIVARFGL----G-KKKGTKKVTKKSSSSGDANRPLWFPGAKCPD 75 
297823921   3 TTTAAAASGIFGIRI------------QDPRPGTGRVQARFGFs--fG-KKKPAPPPKKSRQVQDDGDRLVWFPGANPPE 67 
302807871  76 YLDGSLVGDYGFDPLGLGKPPTYLQFDVDSLDSSLAKNMPGELLGERVeDLSTIRATPLQPYTEIFGLQRFRECELIHGR 155
15225630   68 WLDGSMIGDRGFDPFGLGKPAEYLQYDFDGLDQNLAKNVAGDIIGIIQ-ESSEIKPTPFQPYTEVFGIQRFRECELIHGR 146
168040679  73 WLDGSLPGDYGFDPLSLGKSPEYLQIELDSLNQNLAKNEAGDVIGTRIsKKEEIAPTPFQPYSEVFGLQRFRECELIHGR 152
168040609  73 WLDGSLPGDYGFDPLSLGKSPEYLQIELDSLNQNLAKNEAGDVIGTRIsKKEEIAPTPFQPYSEVFGLQRFRECELIHGR 152
168067076  73 WLDGSLPGDYGFDPLSLGKSPEYLQIELDSLNQNLAKNEAGDVIGTRIsKKEEIAPTPFQPYSEVFGLQRFRECELIHGR 152
242050544  64 YLDGTLVGDYGFDPFGLGKPVEYLQFDLDSLDQNLAKNEPGVVIGTRF-ESSDVKSTPLQPYSEVFGLQRFRECELIHGR 142
224101127  67 WLDGTMVGDRGFDPFALGKPAEYLQFDLDSLDQNLAKNLAGDVIGVRV-DATEVKPTPFQPYSEVFGLQRFRECELIHGR 145
255571917  74 WLDGTMVGDRGFDPFGLGKPAEYLQFELDSLDQNLAKNVAGDIIGVRV-EPNEVKPTPFQPYSEVFGLQRFRECEVIHGR 152
302784975  76 YLDGSLVGDYGFDPLGLGKPPTYLQFDVDSLDSSLAKNMPGELLGERVeDLSTIRATPLQPYTEIFGLQRFRECELIHGR 155
297823921  68 WLDGSMIGDRGFDPFGLGKPAEYLQYDFDGLDQNLAKNVAGDIIGIIQ-DSSEIKPTPFQPYTEVFGIQRFRECELIHGR 146
302807871 156 WAMLATLGAIAVETFTGVTWQDAGKVELDQGPSYFGFSLPFTITALVWIEVLVIGFIEFQRNTELDPEKRLYPGGsYFDP 235
15225630  147 WAMLGTLGAIAVEALTGIAWQDAGKVELVEGSSYLGQPLPFSLTTLIWIEVLVVGYIEFQRNSELDPEKRIYPGG-YFDP 225
168040679 153 WAMLAILGALSVEAFTGVTWQDAGKVELVDGASYFGLPLPFSITSLVYIEAFLVGFIEFQRNAELDPEKRLYPGGkFFDP 232
168040609 153 WAMLAILGALSVEAFTGVTWQDAGKVELVDGASYFGLPLPFSITSLVYIEAFLVGFIEFQRNAELDPEKRLYPGGkFFDP 232
168067076 153 WAMLAILGALSVEAFTGVTWQDAGKVELVDGASYFGLPLPFSITSLVYIEAFLVGFIEFQRNAELDPEKRLYPGGkFFDP 232
242050544 143 WAMLATLGALSVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQRNAELDPEKRLYPGGsYFDP 222
224101127 146 WAMLGTLGAIAVEALTGVAWQDAGKVELIEGSSYLGQPLPFSLTTLIWIEVIVVGYIEFQRNAELDPEKRLYPGG-YFDP 224
255571917 153 WAMLGTLGALAVEALTGVAWQDAGKVELVEGSSYLGQPLPFSLTTLIWIEVLVIGYIEFQRNAELDPEKRIYPGG-YFDP 231
302784975 156 WAMLATLGAIAVETFTGVTWQDAGKVELDQGPSYFGFSLPFTITALVWIEVLVIGFIEFQRNTELDPEKRLYPGGsYFDP 235
297823921 147 WAMLGTLGAIAVEALTGIAWQDAGKVELVEGSSYLGQPLPFSLTTLIWIEVLVVGYIEFQRNSELDPEKRIYPGG-YFDP 225
302807871 236 LGLAADPERKEVLKLAEIKHARLAMVAAFGFAVQAAATGKGPLdnwvthlsdplhtTIIDTFSK 299
15225630  226 LGLAADPEKLDTLKLAEIKHSRLAMVAFLIFALQAAFTGKGPV-------------SFLATFNN 276
168040679 233 LNFADTEDKKETLKLAEIKHARLAMVAALGFAAQAAATGKGPLdnwathladplhtTIFDTFSK 296
168040609 233 LNFADTEDKKETLKLAEIKHARLAMVAALGFAAQAAATGKGPLdnwathladplhtTIFDTFSK 296
168067076 233 LNFADTEEKKETLKLAEIKHARLAMVAALGFAAQAAATGKGPLdnwathladplhtTIFDTFSK 296
242050544 223 LGLAADPEKKERLQLAEIKHARLAMVAFLGFAVQAAATGKGPLnnwathlsdplhtTIFDTFGA 286
224101127 225 LGLASDPEKIENLQLAEIKHARLAMVAFLIFGIQAAFTGKGPI-------------SFVATFNN 275
255571917 232 LGLASDPEKKENLQLAEIKHSRLAMVAFLIFGIQAAFTGKGPI-------------AFVATFNQ 282
302784975 236 LGLAADPERKEVLKLAEIKHARLAMVAAFGFAVQAAATGKGPLdnwvthlsdplhtTIIDTFSK 299
297823921 226 LGLAADPEKLDTLKLAEIKHSRLAMVAFLIFALQAAFTGKGPI-------------SFLATFNN 276
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap