Conserved Protein Domain Family
PLN00185

?
PLN00185: PLN00185 
60S ribosomal protein L4-1; Provisional
Statistics
?
PSSM-Id: 177779
View PSSM: PLN00185
Aligned: 29 rows
Threshold Bit Score: 601.022
Threshold Setting Gi: 219113891
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224144519   1 AAAAARPLVSVQPLPAslnDMATDSVTTVALPDVMKASIRPDIVNYVHSNISKNSRQPYAVSKKAGHQTSAESWGTGRAV 80 
219113891   1 --MTARPLVSVFSLSG-------DKSGDVSLPAVMTAPLRPDIVQFVHTNMNKNHRQAYAVNIRAGKQVVASSWGTGRAV 71 
145354643   1 -MPAALPVVSVQGGNG----------ATSALPEVFLSPIRPDIVNAVHTGLNKNNRQAYAVYNRAGHQTAAESWGTGRAV 69 
159473354   1 -MAAAIPMVEVHSIET------GEKAAQVALPAVFTAPIRPDIVRTIHTNMAKNKRQAYAVFMKAGHQTAAESWGTGRAV 73 
219121527  24 ETMAARPLVSVFSLSG-------DKSGDVSLPAVMTAPLRPDIVQFVHTNMNKNHRQAYAVNIRAGKQVVASSWGTGRAV 96 
224000902   1 --MAARPLVSVFSLTG-------EKAGETTLPEVMTAPMRTDIVQFVHTNMNKNNRQAYAVNVHAGKLVSAESWGTGRAV 71 
255089284   1 -MPAALPTVAVQGSAD-----------TVQLPEVFLSPIRPDIVNAVHTGLNKNNRQAYAVNKRAGHQTAAESWGTGRAV 68 
302761726   1 MAAAARPTVSVQVLEA---GDPTKAGVTAALAEVFKSPIRPDVVRQVHTGIAKNKRQPYAVSKKAGHQTSAESWGTGRAV 77 
302766759   1 MAAAARPTVSVQVLEA---GDPTKAGVTAALAEVFKSPIRPDVVRQVHTGIAKNKRQPYAVSKKAGHQTSAESWGTGRAV 77 
303287893   1 -MPAALPTVTVQNGNG----------ATCQLPEVFLSPIRPDIVNAVHTGLNKNNRQAYAVFNKAGHQTAAESWGTGRAV 69 
224144519  81 SRIPRVSGGGTHRAGQGAFGNMCRGGRMFAPTKTWRRWHRKINVNQKRYAVVSAIAASAIPSLVMARGHRVESVPEMPLV 160
219113891  72 ARIPRVGGGGTSRSGQGAFGNMCRGGRMFDPTKTWRKWNKKINISQKRYAVASALAATAVPALVMSRGHVVDNVPEIPLV 151
145354643  70 SRIPRVPGGGTHRAGQGAFGNMCRGGRMFAPTKVWRRWHRRVNLKEKRYAVCSALAASAVPALLLARGHRVEGVPEVPLV 149
159473354  74 SRIPRVPGGGTHRAGQGAFGNMCRGGRMFAPTKVWRRWHRKINVNQKRYAVVSALAASALPALVMARGHKIEQVPMVPLV 153
219121527  97 ARIPRVGGGGTSRSGQGAFGNMCRGGRMFDPTKTWRKWNKKINISQKRYAVASALAATAVPALVMSRGHVVDNVPEIPLV 176
224000902  72 ARIPRVGGGGTSRSGQGAFGNMCRGGRMFAPTKTWRKWHRKINVTQKRYAVASALAATAVPALVMARGHKVDDVPEIPLV 151
255089284  69 SRIPRVPGGGTHRAGQGAFGNMCRGGRMFAPTKTWRRWHRRVNLKQKRYAVCSALAASAVPSLLMARGHHVESVPEVPLV 148
302761726  78 SRIPRVPGGGTHRAGQGAFGNMCRGGRMFAPTKTYRRWHRKLNINLKRYAVVSALAASAIPSLLLARGHRIEKVPEVPLV 157
302766759  78 SRIPRVPGGGTHRAGQGAFGNMCRGGRMFAPTKTYRRWHRKLNINLKRYAVVSALAASAIPSLLLARGHRIEKVPEVPLV 157
303287893  70 SRIPRVPGGGTHRAGQGAFGNMCRGGRMFAPTKTWRRWHRRVNLKQKRYAVCSALAASAVPALLMARGHAVETVPEVPLV 149
224144519 161 ISDSAESIEKTSTAIKVLKEIGAYPDAEKAKDSQAIRAGKGKMRNRRYISRKGPLIVYGTEGAKLVKAFRNIPGVEVANV 240
219113891 152 VENAVESAKKTSAAKDILSAIGALDDVEKAGESKQIRAGKGKMRNRRYTLRRGPLVIYKSNDG-VEQAFRNLPGVELCCV 230
145354643 150 VDDSASSIKKTAKAVELLKQLGAYADVEKVKASRNIRSGKGKMRNRRYVQRRGPLVVYSEDNG-VTRAFRNIPGVELCSV 228
159473354 154 LDDAVEGVKKTSKALEILKKIGALPDVEKSKDSKSLRAGKGKMRNRRYVMRKGPLVVFANDEG-ISKAFRNLPGVEVTSV 232
219121527 177 VENAVESAKKTSAAKDILSAIGALDDVEKAGESKQIRAGKGKMRNRRYTLRRGPLVIYKSNDG-VEQAFRNLPGVELCCV 255
224000902 152 LDNTLESAKKTSAAKDILAAVGALADVEKAADSKKIRAGKGKARNRRYTLRRGPLVIYKSNDG-VEQAFRNLPGVELCCV 230
255089284 149 LDDSSEAITKTAKAVKLLQEVGAYADVEKVKASRNLRSGKGKMRNRRYVQRKGPLVVYANDSG-ITKAMRNIPGVELCSV 227
302761726 158 VSDALESIEKTSVAVKALKTLGAYEDVEKVKKSRNIRCGKGKMRNRRYVSRRGPLIIYGTEGAKLVKAFTNIPGIEVCNV 237
302766759 158 VSDALESIEKTSVAVKALKTLGAYEDVEKVKKSRNIRCGKGKMRNRRYVSRRGPLIIYGTEGAKLVKAFTNIPGIEVCNV 237
303287893 150 VGDDVESIAKTAKAVALLKSIGAYADVEKVKESRNIRSGKGKMRNRRYVQRRGPLVVYADDDG-ITKAFRNIPGVELCSV 228
224144519 241 ERLNLLRLAPGGHLGRFVIWTKSAIEKLDSIYGTFDKSSEKKKGYVLPRTKMVNADLARIINSDEVQSVVNPIKK-EVK- 318
219113891 231 DRLNLLQLAPGGHMGRFCIWSQAALEELDIIYG--------ENGKRIPQAAMTNADLARIINSDEVQSVVNPAKP-GQK- 300
145354643 229 DRLGLLTLAPGGHVGRFIIWTKSAFDKLDSIFGTASKKSASKKGWKPPTNIMAQTDLARLINSDEVQSAVNAPKVgATRa 308
159473354 233 DRLNLLQLAPGGHLGRFCIWSKSAFEKLDKVFGTATTESEQKKGYKLPRACMANGDLARLINSDEIQSAVRPAKSaGPK- 311
219121527 256 DRLNLLQLAPGGHMGRFCIWSQAALEELDIIYG--------ENGKRIPQAAMTNADLARIINSDEVQSVVNPAKP-GQK- 325
224000902 231 DRLNLLQLAPGGHMGRFCIWSQAALDALNTIYG--------KEGKSIPEDLMANADLARIINSDEIQSVLNPAKR-ANK- 300
255089284 228 DRLGLLTLAPGGHVGRFIIWTKSAFEKLDSIYGTSAVKSSAKKGWKPPANIMAMPDLSRVINSDEIQSAINAPKEgKTRa 307
302761726 238 NRLNLLQLAPGGHLGRFIIWTKCAFEKLDEIFGSFDTPAALKKNYLLPRPIMSNSDLSRIINSDEIQSVVRPKIT-DVK- 315
302766759 238 NRLNLLQLAPGGHLGRFIIWTKCAFEKLDEIFGSFDTPAALKKNYLLPRPIMSNSDLSRIINSDEIQSVVRPKIT-DVK- 315
303287893 229 DRLGLLTLAPGGHVGRFIIWTKKAFEKLDAVFGTAAAASSAKKGWKPPRSIMTVPDLSRVINSDEIQSAVNAPKAgKTRa 308
224144519 319 RAPLKKNPLKNLNVMLKLNPYAKTARRMALLAEAERVKSKKEKLDR--KRKPVSKEELAAAKAAGKAWYKTMISDSDYT- 395
219113891 301 EYAPKQNAIRNVEALEKLDPYAAEKRRRNFGEEA---------------------------------------------- 334
145354643 309 HAPLKRNPLKNKSAMERLNPYAKVAREMQARAQEERSKAKAKKSAT--ARSALASRAQRNGQRRGAAGDRVRRKRQPRA- 385
159473354 312 HAPLKKNPLRNLGAMLKLNPYAKVARRVEITRSTKKAAKRSEKLAKiaKGEKTGGQKDKAIKAIGKKFYKNMLVESDYAg 391
219121527 326 DNAPKQNAIRNVEALEKLDPFAAEKRRAQARNDEARASKKAETLAK--KRD--SRTAKKAFKEQGKSFYAKVNEKR---- 397
224000902 301 KFLRKKNPLTSIKALAKLDPYAAAARESEQRAEAARKDQKAAILKK--RRETAKEDSLIV-------------------- 358
255089284 308 HAPLKRNPLKNKSAMERLNPYAKVAAEMRAKAEAASSAAKAKKTAG-------------ARSKVGQAFYEGMKKESNYEg 374
302761726 316 RAPLKRNPLKNFNAMVKLNPYASTARKM---MEERRKNAKEEKLAA--KRAQ-NPEEKAAISKAGNLWYKTMISDSDYL- 388
302766759 316 RAPLKRNPLKNFNAMVKLNPYASTARKM---MEERRKNAKEEKLAA--KRAQ-NPEEKAAISKAGNLWYKTMISDSDYL- 388
303287893 309 HAPLKRNPLKNKAAMERLNPYAKVAAQMAAAAEKERSAAKAKKVAG-------------ARSKVGEAFYQGMKSDSAYEg 375
224144519 396 -EFENFTKWLGVSQ 408
219113891     --------------    
145354643 386 ------------QR 387
159473354 392 dDYDLFARWITVQK 405
219121527     --------------    
224000902 359 -VFAGVLKICSRLR 371
255089284 375 eLFDGFATWLKGKP 388
302761726 389 -DFENFSKWLGVSQ 401
302766759 389 -EFENFSKWLGVSQ 401
303287893 376 eLFDNFAEWLHGKP 389
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap