Conserved Protein Domain Family
PLN00184

?
PLN00184: PLN00184 
aquaporin NIP1; Provisional
Statistics
?
PSSM-Id: 177778
View PSSM: PLN00184
Aligned: 4 rows
Threshold Bit Score: 547.312
Threshold Setting Gi: 15234059
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
297804258   1 MAEISGNGHGaDARDGAVVVNLKEEDEHQQQKEAIHNPKPMKKQDSLLSISVPFLQKLMAEVLGTYFLIFAGCAAVAVNT 80 
18415224    1 MADISGNGYG-NAREEVVMVNLKDEVEHQQEMEDIHNPRPLKKQDSLLSVSVPFLQKLIAEFLGTYFLVFTGCASVVVNM 79 
15234059    1 MAEISGNG-G-DARDGAVVVNLKEEDEQQQQQQAIH--KPLKKQDSLLSISVPFLQKLMAEVLGTYFLIFAGCAAVAVNT 76 
297800156   1 MADISGNGYG-NARE-VVMVNLKEEVEHQQEMEAIHNPKPLKKQDSLLSVSVPFLQKLIAESLGTYFLVFTGCASVVVNM 78 
297804258  81 QHDKAVTLPGIAIVWGLTVMVLVYSLGHISGAHFNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQD 160
18415224   80 QNDNVVTLPGIAIVWGLTIMVLIYSLGHISGAHINPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDHD 159
15234059   77 QHDKAVTLPGIAIVWGLTVMVLVYSLGHISGAHFNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQD 156
297800156  79 QNDNVVTLPGIAIVWGLTIMVLIYSLGHISGAHINPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDHD 158
297804258 161 VCSGKHDVFVGTLPSGSDLQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVSGASMNPGRSLG 240
18415224  160 VCSGKHDVFIGSSPVGSDLQAFTMEFIVTFYLMFIISGVATDNRAIGELAGLAIGSTVLLNVLIAAPVSSASMNPGRSLG 239
15234059  157 VCSGKHDVFVGTLPSGSNLQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVSGASMNPGRSLG 236
297800156 159 VCSGKHDVFIGSSPVGSDLQAFVMEFIVTFYLMFIISGVATDNRAIGELAGLAIGSTVLLNVLIAAPVSSASMNPGRSLG 238
297804258 241 PAMVYSCYRGLWIYIVSPIVGAVSGAWVYNMVRYTDKPLREITKSGSFLKTVRNGSS 297
18415224  240 PALVYGCYKGIWIYLVAPTLGAIAGAWVYNTVRYTDKPLREITKSGSFLKTVRIGST 296
15234059  237 PAMVYSCYRGLWIYIVSPIVGAVSGAWVYNMVRYTDKPLREITKSGSFLKTVRNGSS 293
297800156 239 PAMVYGCYKGIWIYIVAPTLGAIAGAWVYNTVRYTDKPLREITKSGSFLKSVRIGSS 295
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap