Conserved Protein Domain Family
PLN00182

?
PLN00182: PLN00182 
putative aquaporin NIP4; Provisional
Statistics
?
PSSM-Id: 165748
View PSSM: PLN00182
Aligned: 5 rows
Threshold Bit Score: 483.257
Threshold Setting Gi: 224069322
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15240347    1 MSSHSDEIEEEQISRIEKG--KGKDCQGGIETVICTSPSIVCLTQKLIAEMIGTYFIVFSGCGVVVVNVLYGGTITFPGI 78 
15240348    1 MTSHGEEIEDEQISRIEKG--NCKDSQGGMETAICSSPSIVCLTQKLIAEMIGTYFIIFSGCGVVVVNVLYGGTITFPGI 78 
224069322   1 MARKSDGIESQEITSMEEGlaTPTDPKENGKFDCCTSPAAVTITQKLIAEVIGTYFVIFAGCGSVAVNNIY-GSVTFPGV 79 
297801318   1 MSLHSDEIEEEQISRIEKG--KGKDCHGGIETVICTSPSIVCLTQKLIAEMIGTYFIVFSGCGVVVVNVLYGGTITFPGI 78 
297801320   1 MTSHCEEIEAEQISRIEKG--NGKDSQGGIETAICTSPSIVCLTQKLIAEMIGTYFIIFSGCGVVVVNVLYGGTITFPGI 78 
15240347   79 CVTWGLIVMVMIYSTGHISGAHFNPAVTVTFAIFRRFPWHQVPLYIGAQFAGSLLASLTLRLMFKVTPEAFFGTTPADSP 158
15240348   79 CVTWGLIVMVMIYSTGHISGAHFNPAVTVTFAVFRRFPWYQVPLYIGAQLTGSLLASLTLRLMFNVTPKAFFGTTPTDSS 158
224069322  80 CVTWGLIVMVMIYSLGHISGAHFNPAVTIAFAIFRRFPSWQVPLYIIAQLMGSILASGTLALALDVTPEAFFGTVPVGSD 159
297801318  79 CVTWGLIVMVMIYSTGHISGAHFNPAVTVTFAIFRRFPWYQVPLYIGAQFAGSLLASLTLRLMFKVTPEAFFGTTPADSP 158
297801320  79 CVTWGLIVMVMIYSTGHISGAHFNPAVTVTFAVFRRFPWFQVPLYIGAQLTGSLLASLTLRLMFNVTPKAFFGTSPTDSS 158
15240347  159 ARALVAEIIISFLLMFVISGVATDNRAVGELAGIAVGMTIMVNVFVAGPISGASMNPARSLGPALVMGVYKHIWVYIVGP 238
15240348  159 GQALVAEIIISFLLMFVISGVATDSRATGELAGIAVGMTIILNVFVAGPISGASMNPARSLGPAIVMGRYKGIWVYIVGP 238
224069322 160 GQSLVLEIIISFLLMFVISGVSTDDRAVGDLAGIAVGMTILLNVFVAGPVSGASMNPARSIGPAVVKHQFKGLWVYIVGP 239
297801318 159 ARALVAEIIISFLLMFVISGVATDNRAVGELAGIAVGMTIMLNVFVAGPISGASMNPARSLGPALVMGVYTHIWVYILGP 238
297801320 159 GQALVAEIIISFLLMFVISGVATDSRATGELAGIAVGMTIILNVFVAGPISGASMNPARSLGPAIVMGRYKGIWVYIVGP 238
15240347  239 VLGVISGGFVYNLIRFTDKPLRELTKSASFLRAVSPSHKGSSSKT 283
15240348  239 FVGIFAGGFVYNFMRFTDKPLRELTKSASFLRSVAQKDNASKSDG 283
224069322 240 IIGAIAGAFACNLIRWTDKPLGELTKVGSFIKSGSKNYAS----- 279
297801318 239 VLGVISGGFVYNLIRFTDKPLRELTKSASFLRAVSPSHKASSSKT 283
297801320 239 FVGIFAGGFVYNFMRFTDKPLRELTKSASFLRSVAQKNNASKSEG 283
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap