Conserved Protein Domain Family
PLN00181

?
PLN00181: PLN00181 
protein SPA1-RELATED; Provisional
Statistics
?
PSSM-Id: 177776
View PSSM: PLN00181
Aligned: 5 rows
Threshold Bit Score: 1520.78
Threshold Setting Gi: 297834396
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22331100    1 MEGSSNSNSRGF-NTSGVSDRNTEflpverlttRSKPSSHVDeYVRSLFGStstHKSGEDDSLGIDPFVRSLEWGDVSLR 79 
30695417    1 MKGSSESSSRGLnNTSGVSEFCTD---------GSKSLSHID-YVRSLLGS---HKEANLGGLDDDSIVRALECEDVSLR 67 
15219179    1 MKGSSESSSRGLnNTSGVSEFCTD---------GSKSLSHID-YVRSLLGS---HKEANLGGLDDDSIVRALECEDVSLR 67 
297847694   1 MKGSSESNSRGLnNTSGVSEFCTD---------GSKSLSHID-YVRSLLGS---HKEDNLVGLDDDSIVRALECEDVSLR 67 
297834396   1 MEGSSNSNSRGF-NTSGLSDRNTEflpveritaRSKPSSHVDeYVRSLFGStstHKSGEDDSLGIDPFVSSLEWGDVSLR 79 
22331100   80 QWLDKPERSVDVFECLHVFRQIVEIVNAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDslEDGPISQKEIGS 159
30695417   68 QWLDNPDRSVDAFECFHVFRQIVEIVNAAHSQGIVVHNVRPSCFVMSSFNNVSFIESASCSDSGSD--EDATTKSREIGS 145
15219179   68 QWLDNPDRSVDAFECFHVFRQIVEIVNAAHSQGIVVHNVRPSCFVMSSFNNVSFIESASCSDSGSD--EDATTKSREIGS 145
297847694  68 QWLDNPDRSVDAFECFHVFRQIVEIVNAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSD--EDATTKSREIGS 145
297834396  80 QWLDKPERSVDVLECLHVFRQIVEIVNAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDslEDGPISQKEIGS 159
22331100  160 SRREEAVSkaiaieekgvynkllERKIEKLEEEKTQPFPMKHILAMETSWYTSPEEDFGSSSTCASDVYRLGVLLFELFC 239
30695417  146 SRQEEILS---------------ERRSKQQEEVKKQPFPMKQILAMEMSWYTSHEEDNGSLCNCASDIYRLGVLLFELFC 210
15219179  146 SRQEEILS---------------ERRSKQQEEVKKQPFPMKQILAMEMSWYTSHEEDNGSLCNCASDIYRLGVLLFELFC 210
297847694 146 SRKDEFL----------------------LEEVTKQPFPMKQILAMEMTWYTSPEEDNGSPSNCASDVYRLGVLLFELFC 203
297834396 160 SRREETVSkaiakeekgvynkflERRIEKLEEEKNQPFPMKHILAMETSWYTSPEEDFGSSSTCASDVYRLGVLLFELFC 239
22331100  240 PVPSREEKSRTMSSLRHRVLPPQILLKCPKEASFCLWLLHPEPTCRPSMSDLLQSEFITEPRDNLEEREAAIELRDRIEE 319
30695417  211 PVSSREEKSRTMSSLRHRVLPPQILLNWPKEASFCLWLLHPEPSCRPSMSELLQSEFINEPRENLEEREAAMELRDRIEE 290
15219179  211 PVSSREEKSRTMSSLRHRVLPPQILLNWPKEASFCLWLLHPEPSCRPSMSELLQSEFINEPRENLEEREAAMELRDRIEE 290
297847694 204 PVSSREEKSRTMSSLRHRVLPPQILLNWPKEASFCLWLLHPEPSYRPSMSELLQSEFINEPRENLEEREAAMELRDRIEE 283
297834396 240 PVPSREEKSRTMSSLRHRVLPPQILLKCPKEASFCLWLLHPEPSCRPSMSDLLQSEFITEPRDNLEEREAAIELRDRIEE 319
22331100  320 QESLLEFLLLIQQRKQESAYRLQDTVSLLSSDIEQVVKRQLILKKRGSSLsdfskddhqytsgqplmsfqaneepSAFLA 399
30695417  291 QELLLEFLFLIQQRKQEAADKLQDTISLLSSDIDQVVKRQLVLQQKGRDV-------------------------RSFLA 345
15219179  291 QELLLEFLFLIQQRKQEAADKLQDTISLLSSDIDQVVKRQLVLQQKGRDV-------------------------RSFLA 345
297847694 284 QELLLEFLFLIQQRKQEAADKLRDTISLVSSDIDQVVKRQLVLQQKGSDV-------------------------RSFLA 338
297834396 320 QESLLEFLLLIQQRKQESAYRLRDTVALLSSDIEQVVKRQLILKKKGSSLsdfskddhqypsgqplisfqaneepSAFLA 399
22331100  400 SRKRVRQGILALENGVEVD----------EESQGSTLLESSRLMRNFKKLESVYFLTRRRQMKAAASG-KSLTRHSPLSS 468
30695417  346 SRKRIRQGAETTAAEEENDdnsideesklDDTLESTLLESSRLMRNLKKLESVYFATRYRQIKAATAAeKPLARYYSALS 425
15219179  346 SRKRIRQGAETTAAEEENDdnsideesklDDTLESTLLESSRLMRNLKKLESVYFATRYRQIKAATAAeKPLARYYSALS 425
297847694 339 SRKRIRQGAETAAAEEENDeee----sklDDTLESTLLESSRLMRNLKKLESVYFATRYRQIKAAAAAeKPLARYYSALS 414
297834396 400 SRKRFRQGISALEDDVEVD----------EESQGSTLLESSRLMRNFKKLESVYFLTRRRQMKAAASG-KSLTRHSPLSS 468
22331100  469 ENGRGsmivSEKSSVSNPVAPKaffNNDSRQGGWIDPFLEGLCRYLSFSQLRVKADLKQGDLLNSSNLVCALAFDREGEL 548
30695417  426 CNGRS----SEKSSMSQPSKDP---INDSRQGGWIDPFLEGLCKYLSFSKLRVKADLKQGDLLNSSNLVCAIGFDRDGEF 498
15219179  426 CNGRS----SEKSSMSQPSKDP---INDSRQGGWIDPFLEGLCKYLSFSKLRVKADLKQGDLLNSSNLVCAIGFDRDGEF 498
297847694 415 SNGRS----SEKSSMSSPAQPPkdpINDSRQGGWIDPFLEGLCKYLSFSKLRVKADLKQGDLLNSSNLVCAIGFDRDGEF 490
297834396 469 ENGRGsmivSEKSSVSNPAVPKdfyNHDLRQGGWIDPFLEGLCRYLSFSQLRVKADLKQGDLLNSSNLVCALAFDRDGEF 548
22331100  549 FATAGVNKKIKIFECNSIVNDNRDIHYPVVELAGRSKLSSLCWNSYIKSQIASSNFDGVVQIWDVARSQLVTEMKEHKKR 628
30695417  499 FATAGVNKKIKIFECESIIKDGRDIHYPVVELASRSKLSGICWNSYIKSQVASSNFEGVVQVWDVARNQLVTEMKEHEKR 578
15219179  499 FATAGVNKKIKIFECESIIKDGRDIHYPVVELASRSKLSGICWNSYIKSQVASSNFEGVVQVWDVARNQLVTEMKEHEKR 578
297847694 491 FATAGVNKKIKIFECESIIKDGRDIHYPVVELASRSKLSGICWNSYIKSQVASSNFEGVVQVWDAARSQLVTEMKEHEKR 570
297834396 549 FATAGVNKKIKIFECNSIVNNNRDIHYPVVELAGRSKLSSLCWNSYIKSQIASSNFDGVVQIWDVARCQLVTEMKEHRKR 628
22331100  629 VWSIDISSADPTLLASGSDDGT--------GVSIGTIKTKANVCCVQFPSDSGRSLAFGSADHKVYYYDLRNPKIPLCTM 700
30695417  579 VWSIDYSSADPTLLASGSDDGSvklwsinqGVSIGTIKTKANICCVQFPSETGRSLAFGSADHKVYYYDLRNPKLPLCTM 658
15219179  579 VWSIDYSSADPTLLASGSDDGSvklwsinqGVSIGTIKTKANICCVQFPSETGRSLAFGSADHKVYYYDLRNPKLPLCTM 658
297847694 571 VWSIDYSSADPTLLASGSDDGSvklwsinqGVSIGTIKTKANICCVQFPSESGRSLAFGSADHKVYYYDLRNPKLPLCTM 650
297834396 629 VWSIDISSADPTLLASGSDDGT--------GVSIGTIKTKANVCCVQFPSDSGRSLAFGSADHKVYYYDLRNPKIPLCTM 700
22331100  701 IGHSKTVSYVKFVDSSTLVSSSTDNTLKLWDLSMSASGINESPLHSFTGHTNLKNFVGLSVSDGYIATGSETNEVFVYHK 780
30695417  659 IGHHKTVSYVRFVDSSTLVSSSTDNTLKLWDLSMSISGINETPLHSFMGHTNVKNFVGLSVSDGYIATGSETNEVFVYHK 738
15219179  659 IGHHKTVSYVRFVDSSTLVSSSTDNTLKLWDLSMSISGINETPLHSFMGHTNVKNFVGLSVSDGYIATGSETNEVFVYHK 738
297847694 651 IGHNKTVSYVRFMDSSTLVSSSTDNTLKLWDLSMSISGVNETPLHSFMGHTNVKNFVGLSVSDGYIATGSETNEVFVYHK 730
297834396 701 IGHSKTVSYVKFVDSSTLVSSSTDNTLKLWDLSMSASGINETPLHSFTGHTNLKNFVGLSVSDGYIATGSETNEVFVYHK 780
22331100  781 AFPMPVMSYMFNNTDSMSGLEVDDASQFISSICWRGQSSTLVAANSNGNIKILEMM 836
30695417  739 AFPMPVLSYKFKTIDPVSELEVDDASQFISSVCWRGQSSTLVAANSTGNIKILEMV 794
15219179  739 AFPMPVLSYKFKTIDPVSELEVDDASQFISSVCWRGQSSTLVAANSTGNIKILEMV 794
297847694 731 AFPMPVLSYKFKTIDPVSDLEVDDASQFISSVCWRGQSSTLVAANSTGNIKILEMV 786
297834396 781 AFPMPVMSYMFNNTDSVSGLEVDDASQFISSICWRGQSSTLVAANSNGNIKILEMM 836
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap