Conserved Protein Domain Family
PLN00180

?
PLN00180: PLN00180 
NDF6 (NDH-dependent flow 6); Provisional
Statistics
?
PSSM-Id: 177775
View PSSM: PLN00180
Aligned: 9 rows
Threshold Bit Score: 262.46
Threshold Setting Gi: 242076008
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
242076008   1 MASPLLKPHSHVAAAAALHSARRSADRHGrcpatvhlaGRFHDHGRSRSGRSKRSGSAKVSALPslEVVPLMVTMVEHVD 80 
186478620   4 AFTSFTFTNLHIPSSYNHSPKQNSGPNHG---------YWLSNVNEKRERNLMRGSLCVRKALP--HDLPLMAVMVQQIE 72 
115448639   1 MALPLLKSSPHFSALHSANRAQLHGRCRAtl-----ggFHDPRSNSSRCKKSAGRGSVKANASPl-DVVTLMVTMVEHVD 74 
22329662    4 AFTSFTFTNLHIPSSYNHSPKQNSGPNHGy--------WLSKNVNEKRERNLMRGSLCVRKALP--HDLPLMAVMVQQIE 73 
242066004   1 MGSPLLKSHSQLAAAAALHSARRADRHGRcpatvnlgrFHDHGLRSARS---KRSGSAKVSAFPslDVVPLMVTMVEHVD 77 
225457381   4 AIMGFTIMKPNFHNSYAQPTKMDISPCSRllrqcsssrFNNGWHQTESS-KSKRASLCRVNALP---DWPLMAVLVEHVE 79 
224119070   4 AITGFTITKPHMLSSLQ-KTKLDLKPCSGelwqcssdgLLSGWLQHKRS-NKKRASLSKVNAFP---DWPLMAVMVEHIE 78 
255547361   5 AIMGFTITKSHLHNSFS-PTKLDLNPSSRlhkqcsssrFFNGWQQAEGSKSKSRGSLSKVNAFP---DLTLMAVLVEHME 80 
297844834   4 AFTSFTFTNLHIPSSSSHSPKQISGPKHGy--------SLSMKVNEKREKNLMRGSLCVRKALP--HDLPLMAVMVQQIE 73 
242076008  81 MSRDYVVTKSIWHLSDAALKSVYTFYAMFTVWGVCFFASMKDPFYDSDTYRSAGGDGTVHWYYDRQEDLEASAREELLRE 160
186478620  73 GMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCLYFGSAKDPFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWRE 152
115448639  75 LQRDYVVHKSIWHLSDAALKSVYTFYAFFTVWGICFFASMKDPFYDSEAYRGQGGDGTVHWYYDRQEDLEASAREELLRE 154
22329662   74 GMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCLYFGSAKDPFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWRE 153
242066004  78 MSRDYVVTKSIWHLSDAALKSVYTFYAMFTVWGVCFFASMKDPFYDSDTYRSQGGDGTVHWYYDRQEDLEASAREELLRE 157
225457381  80 GQRDLITHKSIWHLNDETIKNVYTFYIMFTCWGCCFFGSTKDPYYDSEQYRKDGGDGTGHWVYEKQEDIEEAARAELWRE 159
224119070  79 GQRDLITHKSIWHLSDRAIKNVYVFYLMFTCWGCLFFGSMKDPYYDSEAYRKDGGDGSGHWVYDKQDDIEESARAELWRE 158
255547361  81 GQRDLITNKTIWHLSDRAIKNVYVFYLMFTCWGCLFFGSMKDPFYDSEEYRKDGGDGTGHWIYEKQEDIEESARAELWRE 160
297844834  74 GMRDIITEKHVWHLSDKAIKNVYMFYIMFTCWGCLYFGSAKDPFYDSEEYRGDGGDGTGYWVYETQEDIEEKARAELWRE 153
242076008 161 ELLEEIEQRVGGLRELEEVVTK 182
186478620 153 ELIEEIEQKVGGLRELEEAVTK 174
115448639 155 ELLEEIEQRVGGLRELEEAAKE 176
22329662  154 ELIEEIEQKVGGLRELEEAVTK 175
242066004 158 ELLEEIEQRVGGLRELEEVVTK 179
225457381 160 ELIEEIEQKVGGLRELEEAGRK 181
224119070 159 ELIEEIEQKVGGLRELEEAGRK 180
255547361 161 ELIEEIEQKVGGLRELEEAGRK 182
297844834 154 ELIEEIEQKVGGLRELEEAVTK 175
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap