Conserved Protein Domain Family
PLN00178

?
PLN00178: PLN00178 
sulfite reductase
Statistics
?
PSSM-Id: 177773
View PSSM: PLN00178
Aligned: 21 rows
Threshold Bit Score: 1088.25
Threshold Setting Gi: 219110645
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
219110645   1 MKFSSSAAAALLLLQSYSTTAFSFHPARVTSRRQRTSSLSMVLEKPK---PKKL-PKIEQLKIDSNHLVHPLIEQLKTEE 76 
145352813   7 RSTMARAVPTPATRAHRAVTRAGTTVKRAKNRRCVVTNVATPSSGAQk-ePAKR-SKVEIIKENSDYLRHPLIEELATTA 84 
159482494   1 ------------MLLHAPHVKPLGQRSSIRRGNLVVANVACTAGKNPtsrPAKR-SKVEFIKENSDHLRHPLMEELVNDE 67 
168041602   9 LGVSAPFAAFDGLRVSAAGQQRATVRGVSLPGSLDVRAVATPVKPPTt-mPPKR-SKVEIIKQNSDFLRHPLKEDLTTDA 86 
168057141   1 -------------------------------------------------mPPKR-SKVEIIKQNSDFLRHPLKEELETEA 30 
168057067  29 APPSFSSFSGLRVRRNGEHEAQVSSSRGAAVGTLRVRAVATPVRPPTt-mPPKR-SKVEIIKQNSDFLRHPLKEELETEA 106
255084948  20 RVSPVAFRPLESRPQNGVKRASRVRASVARRVANPIVAVATPSGKKSaneGEKNwSKVEYIKENSDFLRHPLIEQLATED 99 
302765188   1 ----------------------MTGPGSWDGRGTAGLAPAAPRPWPPatlPAKR-SKVELIKENSNFLRFPLREELETEA 57 
302776642   1 ----------------------------------------------------KR-SKVELIKENSNFLRFPLREELETEA 27 
302834481   1 -------------MQALAGKQLSAGLSRPSRGQLVVTSVATPSKNPAs-rLAKR-SKVEIIKENSDYLRHPLMEELVNDK 65 
219110645  77 ISISKDAYQILKYHGSYMQNNRETKG---PKDYQFMLRLKQPAGELPPDLYRLLDDLSREKGQGDLRATTRQCFQMHGIL 153
145352813  85 SNISEDAAQLYKFHGGYQQDDREKRAfgeGKFYQFMMRTKQPAGKVPNKLYLTMDDLANTHGNGTLRLTTRQTYQLHGIL 164
159482494  68 TFITEDSVQLMKFHGSYQQDNREKRAfgqGKAYSFLMRTRQPAGVVPNRLYLVMDDLADQFGNGTLRLTTRQAYQLHGVL 147
168041602  87 PNVSEDAVQLIKFHGSYQQDNRELRGp-gKKAYQFMLRTKNPSGIVPNRLYLVMDELADKYGIGTLRLTTRQTFQLHGVL 165
168057141  31 PNVNEDAVQLIKFHGSYQQDNRELRGp-gHKAYQFMLRTKNPSGIVPNRLYLVMDELADKYGIGTLRLTTRQTFQLHGVL 109
168057067 107 PNVNEDAVQLIKFHGSYQQDNRELRGp-gHKAYQFMLRTKNPSGIVPNRLYLVMDELADKYGIGTLRLTTRQTFQLHGVL 185
255084948 100 PFISEDAAQLYKFHGGYQQDDREKRAfgaGKFYQFMMRTKQPAGTVPNKLYLTMDDLADSHGNGTLRLTTRQTYQLHGIL 179
302765188  58 PNINESAVQLIKFHGSYQQADRDVRS---GKAYQFMLRTKQPAGIVTNQLYKVMDDLADEFGSGTLRLTTRQTFQLHGVL 134
302776642  28 PNINESAVQLIKFHGSYQQADRDVRS---GKAYQFMLRTKQPAGIVTNQLYKVMDDLADEFGSGTLRLTTRQTFQLHGVL 104
302834481  66 TYITEDSVQLMKFHGSYQQDHREKRSfgsGKAYMFMMRTRQPGGIVPNRLYLVMDELADKFGNGTLRLTTRQAYQLHGVL 145
219110645 154 KGSLKEVIASIMNIGSSTVGACGDVSRNVMTTPAPFA---HPAYEHAREWSKVFAQLFRPMTPAFSQIWLDGEKAATVes 230
145352813 165 KSDLKETFATVIRNMGSTLGACGDINRNVTASPAPYAn--KPEYDIAQELAKDIADLLAPQSGAYYDVWLDGEQIMTA-- 240
159482494 148 KKDLKTVFSSVIKNMGSTLAACGDVNRNVMGPAAPFTn--RPDYLAAQKAALDLADLLTPQSGAYYDVWLDGEKFMSSyk 225
168041602 166 KTDLKTVMSSIIHNLGSTLGACGDVNRNVLAPAAPFK---TTEYMHATELSTKIASLLAPQAGAYYDIWVDGEKITQD-- 240
168057141 110 KTDLKTVMSSIIKNLGSTLGACGDVNRNVLAPAAPYK---SKEYVHAQELASKLAMLLAPQAGAYYDIWVDGEKITQD-- 184
168057067 186 KTDLKTVMSSIIKNLGSTLGACGDVNRNVLAPAAPYK---SKEYVHAQELASKLAMLLAPQAGAYYDIWVDGEKITQD-- 260
255084948 180 KTDLKSTFQAVIRNMGSTLGACGDINRNVMASPAPYAknfKPEYAIAQELAKDIGDLLAPQSGAYYDVWLDGEQVLTV-- 257
302765188 135 KHNLKTVMSTIIKNMGSTLGACGDVNRNVLAPAAPFKn--RKDYLYAVEAADKLAALLAPQAGSYYDLWVDGEKVMSA-- 210
302776642 105 KHNLKTVMSTIIKNMGSTLGACGDVNRNVLAPAAPFKn--RKDYLYAVEAADKLAALLAPQAGSYYDLWVDGEKVMSA-- 180
302834481 146 KHDLKTVFSTVIKNMGSTLAACGDVNRNVMGPAAPYLn--KPEYVHAQKLANDIADLLAPQSGAYYDMWLDGEKFVSIyk 223
219110645 231 WHTEVSgynideVMKHDTGRGVVLNDSVEPLYGDRYLPRKFKIGVTVPGDNSLDIYTNDIGAVVITDSaGNLEGFNIMVG 310
145352813 241 EKPEVT------AARMENRHGTNFEGSPEPIYGSLFLPRKFKIGVTVEGDNHIDVLTNDIGIVVVMRD-GKHVGYNVYVG 313
159482494 226 EDPAVT------EARAFNGFGTNFDNSPEPIYGSQYLPRKFKIATTVPGDNSVDLFTQDLGVVV--------QGYNLYVG 291
168041602 241 EPEDVT------LARNDNSHGTNFEDSPEPIYGIQFLPRKFKIAITVPGDNSVDVLTNDIGIVVVSDEhGEVEGYNLYVG 314
168057141 185 EPEDVT------IARNDNSYGTNFDNSPEPIYGVQFLPRKFKIAVTVPGDNSVDVLTNDIGIVVISDEhGDVQGYNIYVG 258
168057067 261 EPEDVT------IARNDNSYGTNFDNSPEPIYGVQFLPRKFKIAVTVPGDNSVDVLTNDIGIVVISDEhGDVQGYNIYVG 334
255084948 258 EKPEVV------ACRNDNRFGTNFEGSPEPIYGTQFLPRKFKIGVTVPGDNHIDFLTNDIGICVVMKN-GEHVGYNVYAG 330
302765188 211 EPPDVT------QARNDNSHGTNFEGSPEPIYGTQFLPRKFKIAVTVPSDNSVDILTNDIGVVTIVNEaDELQGYNIYVG 284
302776642 181 EPPDVT------QARNDNSHGTNFEGSPEPIYGTQFLPRKFKIAVTVPSDNSVDILTNDIGVVTIVNEaDELQGYNIYVG 254
302834481 224 EDPKVT------ADRAFNGFGTNFENSPEPIYGAQFLPRKFKIAVTVPGDNSVDLFTQDLGVIVVSNDkGEVIGYNLTVG 297
219110645 311 GGMGRTHNKENTFARAADHLGFVSKEDAMELMKCIVATQRDHGNRDVRANARMKYLVHTLGIQDFRKLVESYFGKPIEPW 390
145352813 314 GGMGRSHRNDATFPRAATLLGFCGPRDILYAVKAITCTQRDYGRRDDRKQSRLKYLVESWGMERFKTVTEQYYGKKFEAG 393
159482494 292 GGQGRSHRDADTFPRLADPLGYVAAADLFAAAKAVVAVFRDYGRRDNRKQARTRHMLAEWGVDKFRSVAEQYLGKRFQEP 371
168041602 315 GGMGRTHRNEATFPRLADQLGFVSKDDILYVVKAIVATQRDYGRRDDRRMSRMKYVVEEWGIDKFRTVVEQYFGKKIQPF 394
168057141 259 GGMGRTHRNEQTFPRLADELGYVSKDDILYVVKAIVATQRDYGRRDDRRMSRMKYVVEEWGIHKFKTVVEQYFGKHIQPF 338
168057067 335 GGMGRTHRNEQTFPRLADELGYVSKDDILYVVKAIVATQRDYGRRDDRRMSRMKYVVEEWGIHKFKTVVEQYFGKHIQPF 414
255084948 331 GGMGRSHRNNDTFPRLASALGFVGKDDILYAVKAIACAQRDYGRRDDRKQSRLKYLIHAWGVEKFKAVTEQYMGKAFQPL 410
302765188 285 GGMGRTHRIETSFPRLAEPLGYVSKDDLLHAVKAIVATQRDYGRRDDRRQARMKYLVHDWGIDKFRSVVESYYGKQFETF 364
302776642 255 GGMGRTHRIETSFPRLAEPLGYVSKDDLLHAVKAIVATQRDYGRRDDRRQARMKYLVHDWGIDKFRSVVESYYGKQFETF 334
302834481 298 GGLGRTHRDDETFPRLADPLGYVDKDDIFHAVKAVVAAQRDYGRRDNRKQARLKYLVAEWGIDRFRSVVEQYLGKKFGGF 377
219110645 391 RPMVEWKYSDWMGWWEQGDGKLFCGVHIENGRVKDEgkfrLKTALRRIVDKYNIPMILSPTQSIILRDINPNDKKGIEYL 470
145352813 394 VELAPFEFPTYLGWNEQGDGKLWYGVHVQNGRLRGE----MRKALRNVIERYELPVRLTAQQDMLLTDVDPAWKADIMAT 469
159482494 372 VPLPPWQYKDYLGWGEQGDGRLYCGVYVQNGRIKGE----AKRALRAAIERYSLPVVLTPHQNLVLRDVRPEDREDIEQL 447
168041602 395 KDIPEFKFQSYLGWHEQGDGHLFFGVHVENGRIKGE----AKKVLREVIEKYSLNVRITPNQNMILCDVRPSWRPRITKA 470
168057141 339 KELPPFQFQSYLGWHEQGDGNVFFGLHVENGRIKGE----AKKALREVIEKFKLDVHITPNQNLILCNVRPSWKARITRA 414
168057067 415 KELPPFQFQSYLGWHEQGDGNVFFGLHVENGRIKGE----AKKALREVIEKFKLDVHITPNQNLILCNVRPSWKARITRA 490
255084948 411 ADLPPFTMPTYHGWNEQGDGKLWYGVHVVNGRLRGD----AKKALRAVIERYELPVRLTANQDLLLTDIDPAWKSDIVAT 486
302765188 365 QTLPPWKFESYLGWHEQGDGKLFFGVHVDNGRIKGD----AKKTLREIIESYQLSVRLTPNQNLILCDIRPSWKSRITKT 440
302776642 335 QTLPPWKFESYLGWHEQGDGKLFFGVHVDNGRIKGD----AKKTLREIIESYQLSVRLTPNQNLILCDIRPSWKSRITKT 410
302834481 378 VPMPTWEYQDYLGWGEQGNGKLFYGIYVQNGRIKGE----QKKALRAVIEKFELPVTLTPHQNVILREVDPANKDEIMAM 453
219110645 471 LDAHGIKPIEHVDPLNRLAMACPALPLCGLAQTEAERLMPAYLDRVRGLLNKMNLS-DEEIMIRMTGCPNGCARPYMAEL 549
145352813 470 LQAAGVKDASEVDALERLSMACPALPLCGLAITEAERGLPEINARLRTTMTKVGLAmSDDLVIRMTGCPNGCARPYMAEL 549
159482494 448 LRAGGVKELVEWDGLDRLSMACPALPLCGLAVTEAERALPDVNTRIRAMLTRAGLPpSQPLHVRMTGCPNGCVRPYMAEL 527
168041602 471 LAAVGLVSPRYVDPLNVTAMACPALPLCPLAIAEAERGAPDILKRIRNLFEKVRLKsTESLVVRITGCPNGCARPYMAEL 550
168057141 415 LANVGLLAPKFVDPLNITAMACPALPLCPLAIAEAERGAPDILKRVRAMMDKVGLKaSESLVVRITGCPNGCARPYMAEL 494
168057067 491 LANVGLLAPKFVDPLNITAMACPALPLCPLAIAEAERGAPDILKRVRAMMDKVGLKaSESLVVRITGCPNGCARPYMAEL 570
255084948 487 LTAAGVKDASEIDALDQISIACPALPLCGLAITEAERGLPDINKRLRDVMNKVGLPaDEQFLIRMTGCPNGCARPYQAEL 566
302765188 441 LAQVGLLAPRHIDSLNLTSMACPALPLCPLAIAEAERGIPSILKRIRAMFDKVGLKeADSMVVRVTGCPNGCARPYMAEL 520
302776642 411 LAQVGLLAPRHIDSLNLSSMACPALPLCPLAIAEAERGIPSILKRIRAMFDKVGLKeADSMVVRVTGCPNGCARPYMAEL 490
302834481 454 LRAGGVQELVDWDSIDRMSMACPALPLCGLAVTEAERSLPDINKRIRTMLTKVGLPeDQFVHVRMTGCPNGCARPYMAEL 533
219110645 550 AFVGDGAKSYQVWLGGSPVLTRTAWPFMAKMDVDDLEKTLEPILAMFIQQRQQFEAFGDFCYR----------------- 612
145352813 550 GFVGDGPASYQIWLGGTRAMTGVSSAYAERVKVDDIETFFEPIFAMWAQQRNAGEFFGNFINR----------------- 612
159482494 528 GLVGDGPNSYQLWLGGGPAQTRLAQPYAERVKVKDLESTLEPLFGAWRAGRQPDEAFGDWVAR----------------- 590
168041602 551 GLVGDGPNSYQIYLGGSPNQTRLAESFMERVKLDKLESVLEPLFYMWKSQRQVGESFGDFSFR----------------- 613
168057141 495 GLVGDGPNSYQIWLGGASNQTRLAETFMDRVKLDKLESVLEPVFYMWKSERHEKEGFGDFVYRqvllcclvlagrssmce 574
168057067 571 GLVGDGPNSYQIWLGGASNQTRLAETFMDRVKLDKLESVLEPVFYMWKSERHEKEGFGDFVYR----------------- 633
255084948 567 GFVGDGPGSYQIWMGGTSNLLKLAEPYADKVKEGDFETFFEPIFYAFKTGKNADERFGDWANR----------------- 629
302765188 521 GLVGDGANSYQIWLGGTANQTRLAQTFMEKVKIQDFERVLEPLFYLWKARRTSEESFGDFTMR----------------- 583
302776642 491 GLVGDGANSYQIWLGGTANQTRLAQTFMEKVKIQDFERVLEPLFYLWKARRTSEESFGDFTMR----------------- 553
302834481 534 GFVGDGPNSYQIWLGGNGNQTRLAELYADRVKVKDLENFLEPIFAAWLANRRPNEGFGDWTAR----------------- 596
219110645 613 -----------------------------------------------VGAEAIEAYSNNYRl------------------ 627
145352813 613 -----------------------------------------------VGFDALRAFCDSYVpsaapvaa----aaaaapt 641
159482494 591 -----------------------------------------------LGFDAVRQQAAAAAaaa--------------pv 609
168041602 614 ------------------------------------------------------QVRPVHP------------------- 620
168057141 575 fvkpgdivhyskmdnfhfdekkiasavqllveealivgfspfesfmqQGFGACKTYIENYT------------------- 635
168057067 634 -----------------------------------------------QGFGACKTYIENYT------------------- 647
255084948 630 -----------------------------------------------VGFKAIKDAQESYKglpaaakaaaapaavpaaa 662
302765188 584 -----------------------------------------------Mvlliqmpgivae-------------------- 596
302776642 554 -----------------------------------------------MGFDVLKSHIETYK------------------- 567
302834481 597 -----------------------------------------------TGFPAVKQLAAAAApavvavat----ngngngn 625
219110645 628 GSVRAF 633
145352813 642 AAAVET 647
159482494 610 GTA--- 612
168041602     ------    
168057141 636 GPRKPV 641
168057067 648 GPRKPV 653
255084948 663 AAAAVP 668
302765188     ------    
302776642 568 GPRTGR 573
302834481 626 GNGAAP 631
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap