Conserved Protein Domain Family
PLN00177

?
PLN00177: PLN00177 
sulfite oxidase; Provisional
Statistics
?
PSSM-Id: 177772
View PSSM: PLN00177
Aligned: 9 rows
Threshold Bit Score: 832.962
Threshold Setting Gi: 225451433
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
115477461   1 MPGLTAPASYSDEPPRHPALKINSKEPFNAEPHRSALVSSYITPVDFFYKRNHGPIPIVDDLSRYSVSITGIVNKNVQLS 80 
15232230    1 MPGIRGPSEYSQEPPRHPSLKVNAKEPFNAEPPRSALVSSYVTPVDLFYKRNHGPIPIVDHLQSYSVTLTGLIQNPRKLF 80 
115488430   5 QGALRGPSDYSQEPTRHPSLRINAKEPFNAEATRRDLVASYITPVDLFLKRNHGPIPILHDIDSYYVTVAGLIERPAKLY 84 
224060247   1 MPGVKGPSDYLQEPPRHPSLQINSKYPFNAEPPRSALISSYVTPVDLFYKRNHGPIPVVDDIERYSVLIRGLIDNPRDLF 80 
225451433   1 MPGLRGPSDYSREPARHPCLRINAKAPFNAEPPRSMLITTYVTPVDLFYKRNHGPIPIVDDIERYSVSVRGLIENPKMLS 80 
242089519   3 QSALRGPSDYSSEPPRHPSLRINAKEPFNAEPARRDLAASYITPVDLFFKRNHGPIPILDDIDSYYVTIGGLVGEPRRLS 82 
242082101   1 MPGLTAPSDYAEEPPRHPALKINSKEPFNAEPHRSALVASYITPVDFFYKRNHGPIPKVEDLSRYTVTISGLINKSIQLS 80 
255536913   1 MPGIKGPSDYSQDPPRHPSLKINSKQPFNAEPPRSVLANSYITPMDFFYKRNHGPIPVVDDIERYSVSICGLIGNSKELF 80 
297828558   1 MPGIRGPSEYSQEPPRHPSLKVNAKEPFNAEPPRSALVSSYVTPVDLFYKRNHGPIPIVDHLQSYSVTLTGLIQNPTKLF 80 
115477461  81 MADIRSLPKYDVTATLQCAGNRRTAMSKVRKVRGVGWDISALGNATWGGAKLSDVLELVGIPKLSSVTSLGGKHVEFVSV 160
15232230   81 IKDIRSLPKYNVTATLQCAGNRRTAMSKVRNVRGVGWDVSAIGNAVWGGAKLADVLELVGIPKLTASTNLGARHVEFVSV 160
115488430  85 LNDIKKLPKYNVTATLQCAGNRRTEMSKSRKVRGVGWDVCALGNATWGGAKLSDVLQLIGVPYHTEITPSGGKHVEFTSV 164
224060247  81 MRDIKMLPKYNVTATLQCAGNRRTAMSKVKTVKGVGWDVSAIGNGVWGGAKLADVLELVGISKLTSTTKSGGKHVEFVSI 160
225451433  81 MKDIWDLPKYDVTATLQCAGNRRTAMSKVRTVKGVGWDIAAIGNAVWGGAKLADVLELVGIPKFTSTTQSGGKHVEFVSV 160
242089519  83 LDDIRKLPKYNVTATLQCAGNRRTEMSRSRKVRGVGWDVCALGNATWGGAKLSDVLQLVCVPYHTEITMAGGKHVEFISV 162
242082101  81 MGDIWALPKYNVTATLQCAGNRRTAMSNVRKVRGVGWDISALGTATWGGAKLSDVLELVRIPKLSSVTSLGGKHVEFVSV 160
255536913  81 MRDIWKLPKYNVTATLQCAGNRRTAMSDVKKVRGVGWDVSAIGNAVWGGAKLADVLELVGISKLTSMTKSGGKHVEFVSI 160
297828558  81 IKDIRSLPKYNVTATLQCAGNRRTAMSKVRNVRGVGWDVSAIGNAVWGGAKLADVLELVGIPKLTASTYLGGRHVEFVSV 160
115477461 161 DRCKEEKGGPYKASIPLKQATDPEADVLLAYEMNGETLNRDHGYPLRVVVPGVIGARSVKWLDSINIIEEECQGFFVQKD 240
15232230  161 DRCKEENGGPYKASITLSQATNPEADVLLAYEMNGETLNRDHGFPLRVVVPGVIGARSVKWLDSINVIAEESQGFFMQKD 240
115488430 165 DQCPEEKGGPYKASISLGHATNPAADVLVAYEMNGEVLKRDHGYPLRVVVPGVIGARSVKWLDRIDIIEEECQGFFMQKD 244
224060247 161 DKCKEENGGPYKASIPLSQATNPEADVLVAYEMNGEPLNRDHGYPLRVVVPGVIGARSVKWLDCINIIAEESQGFFMQKD 240
225451433 161 DMCKEENGGPYKASIPLSQASNPEADVLLAYEMNGEPLNRDHGYPLRVIVPGVIGARSVKWLDSINIIAEPCQGFFMQKD 240
242089519 163 DQCPEEKGGPYRASIPLGQATNPAADVLLAYEMNGEVLKRDHGYPLRAIVPGVIGARSVKWLDKIDIIEEESKGFFMQKD 242
242082101 161 DKCKEEKGGPYKASIPLKQATDPDADVLLAYEMNGEVLNRDHGYPLRVVVPGVIGARSVKWLDSINIKEEECQGFFVQKD 240
255536913 161 DKCKEENGGPYKASIPLSQATNPEADVLLAYEMNGEPLNRDHGYPLRVVVPGVIGARSVKWLDSINIIAEECQGFFMQKD 240
297828558 161 DRCKEENGGPYKASIPLSQATNPEADVLLAYEMNGETLNRDHGFPLRVVVPGVIGARSVKWLDSINVIAEESQGFFMQKD 240
115477461 241 YKMFPPSVDWDNINWSTRRPQMDFPVQSAICTLEDVDVIKEGKARIAGYAVSGGGRGIERVDISVDGGKTWVEAHRYQKS 320
15232230  241 YKMFPPSVNWDNINWSSRRPQMDFPVQSAICSVEDVQMVKPGKVSIKGYAVSGGGRGIERVDISLDGGKNWVEASRTQEP 320
115488430 245 YKMFPPSVDWDNIVWSTRKPQMDYPVQSAICSLEDTNAIIPGEVTVTGYALSGGGRGIERVDISTDGGKTWFGAVRYQKE 324
224060247 241 YKMFPPSVNWDNINWSTRRPQMDFPVQSAICSLEDVTAIKPGKVKVSGYAASGGGRGIDRVDVSVDGGKTWVEASRYQKP 320
225451433 241 YKMFPPSVNWDNIEWSTRRPIMDFPIQCAICSLEDINVIKHGKITVSGYAAAGGGRGVERVDISVDGGKTWVEASRYQKP 320
242089519 243 YKMFPPSVDWDNIVWSTRKPQMDYPVQSAVCSLEDKSAVKPGQVTVAGYALSGGGRGIERVDISPDGGKSWIEAHRYQKH 322
242082101 241 YKMFPPTVDWDNINWSTRRPQMDFPVQSAICTLEDVDVIKEGKARIAGYALSGGGRGIERVDISVDGGKTWIEARRYQKD 320
255536913 241 YKMFPPSVNWDNINWSTRRPQMDFPVQCAICSLEDVTTVKPGKVKVSGYAASGGGRGIERVDVSVDGGKTWMEASRHQKT 320
297828558 241 YKMFPPSVNWDNINWSSRRPQMDFPVQSAICSVEDVQMVKPGKVSIKGYAVSGGGRGIERVDISLDGGKNWVEASRTQKP 320
115477461 321 NVPYISDGPRSDKWAWVLFEATLDVPANAEIVAKAVDSAANVQPEKVEDVWNLRGILNTSWHRIKIQNsscvGRSKM 397
15232230  321 GKQYISEHSSSDKWAWVLFEATIDVSQTTEVIAKAVDSAANVQPENVESVWNLRGVLNTSWHRVLLRL----GHSNL 393
115488430 325 GVPYVAGDISSDKWAWVLFKTVIDVKGDTEVIVKAVDSSANVQPESVETIWNLRGILNTCWHRVRLLTih-nLRSLL 400
224060247 321 GVQYISDDMNSDKWAWVLFDVTVDAPQSTEIVVKAVDSAANVQPENVQEIWNLRGILNTSWHRVQVRV----GHSNM 393
225451433 321 GIPYVSDDENNDKWAWVLFEAKVDAPHSTEIVAKAVDTAANVQPESVEEIWNLRGVLNTSWHKVQVRV----GHSAM 393
242089519 323 DVPYVTSDISCDKWAWVLFKAVVNVKGDTVIVSKAVDSSANVQPESVESIWNLRGILNTCWHRVHLLAtp-nLRSFM 398
242082101 321 NVAYVSDGPQSDKWAWVLFEATLDIPANAEIVAKAVDSAANVQPEKVEDIWNLRGILNTSWHRIKIQNs--sGRSKL 395
255536913 321 GVPYISDDMYNDKWAWVLFEVTLDVPHSTKIVAKAVDSAANVQPESVEDIWNLRGILNTSWHRVQVRV----GHSNM 393
297828558 321 GKHYISEHNSSDKWAWVLFEATIDVSQTTEVIAKAVDSAANVQPENVESVWNLRGILNTSWHRVLLRL----GHSNL 393
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap